Property Summary

Ligand Count 1
NCBI Gene PubMed Count 68
PubMed Score 96.03
PubTator Score 73.55

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.800 2.1e-09
glioblastoma 1.800 2.0e-05
group 3 medulloblastoma 1.300 1.2e-03
medulloblastoma, large-cell 2.200 2.2e-07
osteosarcoma 1.625 2.5e-03
pediatric high grade glioma 1.300 2.0e-05
primitive neuroectodermal tumor 1.200 3.2e-05

Protein-protein Interaction (1)

Gene RIF (53)

AA Sequence

MDDIADRMRMDAGEVTLVNHNSVFKTHLLPQTGFPEDQLSLSDQQILSSRQGHLDRSFTCSTRSAAYNPS      1 - 70
YYSDNPSSDSFLGSGDLRTFGQSANGQWRNSTPSSSSSLQKSRNSRSLYLETRKTSSGLSNSFAGKSNHH     71 - 140
CHVSAYEKSFPIKPVPSPSWSGSCRRSLLSPKKTQRRHVSTAEETVQEEEREIYRQLLQMVTGKQFTIAK    141 - 210
PTTHFPLHLSRCLSSSKNTLKDSLFKNGNSCASQIIGSDTSSSGSASILTNQEQLSHSVYSLSSYTPDVA    211 - 280
FGSKDSGTLHHPHHHHSVPHQPDNLAASNTQSEGSDSVILLKVKDSQTPTPSSTFFQAELWIKELTSVYD    281 - 350
SRARERLRQIEEQKALALQLQNQRLQEREHSVHDSVELHLRVPLEKEIPVTVVQETQKKGHKLTDSEDEF    351 - 420
PEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKGLPSV    421 - 490
HAFNTFFFTKLKTAGYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVDFRKKNITYYDSMGGINNEAC    491 - 560
RILLQYLKQESIDKKRKEFDTNGWQLFSKKSQEIPQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYF    561 - 630
RKRMVWEILHRKLL                                                            631 - 644
//

Text Mined References (76)

PMID Year Title