1. Home
  2. Targets
  3. cell adhesion molecule
  4. protease
  5. serine protease
  6. E-selectin

Tchem E-selectin

Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with PSGL1/SELPLG. May have a role in capillary morphogenesis.

The protein encoded by this gene is found in cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. It exhibits structural features such as the presence of lectin- and EGF-like domains followed by short consensus repeat (SCR) domains that contain 6 conserved cysteine residues. These proteins are part of the selectin family of cell adhesion molecules. Adhesion molecules participate in the interaction between leukocytes and the endothelium and appear to be involved in the pathogenesis of atherosclerosis. [provided by RefSeq, Jul 2008]

 Comments

Property Summary

NCBI Gene PubMed Count 401
PubMed Score 2598.83
PubTator Score 2239.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (14)

Disease log2 FC p
cutaneous lupus erythematosus 1.700 2.6e-02
non diabetic and post-ischemic heart fai... -1.700 9.7e-04
type II diabetes mellitus and post-ische... -1.800 1.2e-02
periodontitis 1.200 7.4e-19
Atopic dermatitis 1.900 6.2e-03
pancreatic ductal adenocarcinoma liver m... -1.116 8.4e-03
non-small cell lung cancer -3.605 1.4e-15
lung cancer -3.500 2.9e-06
interstitial cystitis 3.200 2.7e-03
lung adenocarcinoma -1.300 5.9e-05
psoriasis 1.500 1.2e-15
ductal carcinoma in situ 1.300 7.1e-03
ulcerative colitis 3.000 1.8e-04
head and neck cancer 1.900 4.9e-02

Synonym

Accession P16581 A2RRD6 P16111
Symbols ELAM
ESEL
CD62E
ELAM1
LECAM2

Gene

SELE

PANTHER Protein Class (3)

PDB

1ESL   1G1T   1KJA   4C16   4CSY  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (16)

See all...

 GO Function (4)

 GO Component (8)

 GO Process (14)

See all...

 Compartment GO Term (61)

See all...

 MGI Phenotype (12)

See all...

 HCA RNA Cell Line (17)

See all...

Pathway (27)

See all...

Protein-protein Interaction (7)

SPN   SELPLG   DIP2B   DIP2A   MTMR1   MBLAC2   SBF1  

Ligand (106)

Structure of CHEMBL220255

CHEMBL220255
pIC50 6.00

Structure of CHEMBL325286

CHEMBL325286
pIC50 6.03

Structure of CHEMBL117452

CHEMBL117452
pIC50 6.06

Structure of CHEMBL117367

CHEMBL117367
pIC50 6.06

Structure of CHEMBL115534

CHEMBL115534
pIC50 6.06

Structure of CHEMBL118358

CHEMBL118358
pIC50 6.08

Structure of CHEMBL325893

CHEMBL325893
pIC50 6.10

Structure of CHEMBL221163

CHEMBL221163
pIC50 6.10

Structure of CHEMBL119348

CHEMBL119348
pIC50 6.11

Structure of CHEMBL6381

CHEMBL6381
pIC50 6.16

Structure of CHEMBL116958

CHEMBL116958
pIC50 6.17

Structure of CHEMBL115462

CHEMBL115462
pIC50 6.17

Structure of CHEMBL263080

CHEMBL263080
pIC50 6.18

Structure of CHEMBL119522

CHEMBL119522
pIC50 6.19

Structure of CHEMBL323832

CHEMBL323832
pIC50 6.20

Structure of CHEMBL428508

CHEMBL428508
pIC50 6.21

Structure of CHEMBL119711

CHEMBL119711
pIC50 6.22

Structure of CHEMBL267938

CHEMBL267938
pIC50 6.22

Structure of CHEMBL119861

CHEMBL119861
pIC50 6.28

Structure of CHEMBL6371

CHEMBL6371
pIC50 6.30

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
686992 screening 963 / 1107 / 258294 Identification of agents that induce E-selectin on human endothelial cells Measured in Cell-Based System Using Imaging - 2152-01_Activator_SinglePoint_HTS_Activity
977605 confirmatory 17 / 21 / 737 Identification of agents that induce E-selectin on human endothelial cells Measured in Cell-Based System Using Imaging - 2152-01_Activator_Dose_CherryPick_Activity

Gene RIF (403)

PMID Text
26988221 Inhibition of E-selectin expression allows an anti-tumoral effect on sLex-expressing hepatocellular carcinoma tumors in vivo
26937892 These findings provide consistent evidence that A516C and G98T polymorphisms of the SELE gene may be associated with increased susceptibility of coronary artery disease.
26872904 BD patients have a lower expression of ICAM-1, VCAM-1, and E-selectin in their tumor tissues. BD-HDL facilitates the adhesion of tumor cells to vascular endothelium by upregulating the expression of ICAM-1 and VCAM-1, thereby promoting the initial progression of breast cancer metastasis
26868209 Glycosphingolipids likely contribute to human myeloid cell adhesion to E-selectin under fluid shear, particularly the transition of rolling cells to firm arrest.
26828984 The E-selectin S149R polymorphisms is associated with the oncogenesis of breast cancer.
26617843 E-selectin is more effective than cTnI in diagnosing myocardial injury in children.
26396484 Glaucomatous MYOC mutations activate the IL-1beta/NF-kappaB inflammatory stress response and the glaucoma marker SELE in trabecular meshwork cells.
26329844 Data show that both mucin16 (MUC16) and podocalyxin (PODXL)-E-selectin-mediated interactions are mechanically stronger than like L-selectin interactions at the single-molecule level.
26153406 Neisseria meningitidis caused a high level of E-selectin expression elicited by the activity of phosphorylated ATF2 transcription factor on the E-selectin promoter.
26124272 E-selectin interactions with glycoprotein ligands (CD44/hematopoietic cell E-/L-selectin ligand and PSGL-1) mediate the initial capturing of cells out of flow.
26116870 Blood ESEL was higher in pregnant women with preeclampsia, and non-pregnant women with a history of preeclampsia than women without preeclampsia or a history of preeclampsia.
26051909 The number of E-selectin-positive cells was significantly higher in the tuberculoid form than in the lepromatous form of leprosy skin lesions.
25939768 P. gingivalis was shown to activate NOD1, NOD2, and TLR2 expression, resulting in increased E-selectin expression in endothelial cells; direct inhibition of NF-kappaB and P38 MAPK significantly attenuated E-selectin expression induced by P. gingivalis in endothelial cells
25748737 the haplotype TCC in the Han hypertensive patients and the haplotype GGC in the Mongolian patients had independent effects in increasing the risk for essential hypertension; multiple single-nucleotide polymorphisms in combination in SELE may confer a risk of hypertension.
25498912 ST3Gal-4 is the primary sialyltransferase regulating the synthesis of E-, P-, and L-selectin ligands on human myeloid leukocytes
25424718 Gene-based study revealed significant associations of the SELE gene with Blood Pressure phenotypes for the first time among the Chinese Han population.
25345762 Our results did not show significant difference between the compared groups for MCP-1 and E-selectin genes, whereas a significant difference was reported for the IL-6 gene (P < .0001).
25238218 SE-selectin and PAPPA may contribute to future cardiovascular events in women post preeclampsia; in contrast, ApoB may be involved in a protective mechanism
25201247 in human aortic and vein endothelial cells, expression and release of ICAM-1 and E-selectin were induced by treatment with conditioned medium collected from Pal-stimulated pTHP-1 cells
25171839 The findings suggest that C allele carriers of the SELE gene polymorphism (A561C) might be predisposed to EH in the Chinese population.
25168603 Found the AC genotype to be a significant risk factor for hemorrhagic stroke and we also found significant differences in AC genotype and C allele among hemorrhagic stroke and ischemic stroke patients.
25147432 The rs5361 E-selectin gene polymorphism is not a susceptibility marker for ACS in Western Mexico population. However, sE-selectin may be a biological marker of ACS.
25138157 CD44/selectin binding signals increased intercellular adhesion molecule 1 up-regulation on the endothelial cells (ECs)surface through a PKCalpha-p38-SP-1 pathway, which further enhances melanoma cell adhesion to ECs during metastasis
25003340 The C allele of E-selectin A561C gene polymorphism might increase the essential hypertension (EH) risk in Asian population, whereas the T allele of E-selectin C1839T gene polymorphism might decrease the EH risk. [meta-analysis]
25002508 Granulocyte-colony stimulating factor programs myeloperoxidase-E-selectin ligand expression on human blood leukocytes and marrow myeloid cells via induction of N-linked sialofucosylations.
25000467 The aim of this study was to assess circulating E-selectin and P-selectin levels in Legg Calve Perthes patients, which might reflect an endothelium activation and/or injury.
24995349 an upregulation of E-selectin and the associated influx of neutrophils may play a significant role in the resolution of inflammation as well as for the pathophysiology of nasal polyps of Caucasian chronic rhinosinusitis patients.
24980946 SELE rs3917412 and MTHFR rs1801133 SNPs could serve as pharmacogenetic predictors of tumor recurrence in patients with early-stage colon cancer treated with oxaliplatin-based adjuvant chemotherapy
24820735 CD62E was found to be a new biomarker for patients with hypertension and hyperlipidemia.
24815478 there was association between the E-selectin S128R polymorphism and the risk of cancer.
24798295 This study showed that no significant differences in F206L Polymorphism of l-Selectin Between the Patients with Bronchial Asthma and Control.
24699516 High E-Selectin expression is associated with small cell lung cancer metastasis.
24690766 E-selectin promoter was highly and specifically acetylated in the confluent monolayer after tumor necrosis factor alpha activation.
24627030 sE-selectin and the LDL were the most important predictors of late arteriovenous fistula stenosis
24558466 Elevated plasma levels of hsCRP, sICAM-1 and sE-selectin were positively and significantly associated with increased risk of dyslipidemia among Mongolians.
24534074 Data from multiple sites in United States suggest serum level of SELE can be modulated by diet; up-regulation of serum SELE correlates with coronary heart disease risk and may serve as marker of vascular endothelial dysfunction in young adulthood.
24516598 Concentrations of intercellular adhesion molecule (ICAM) -1, E-selectin, L-selectin, and P-selectin in serum samples from patients with systemic sclerosis were measured.
24498435 E-selectin Ser128Arg polymorphism is associated with coronary artery disease risk.
24457076 There were no significant differences in E-selectin immunoreactivity between plasma cell mastitis and normal breast tissue.
24418879 Data suggest that plasma levels of soluble SELE (which correlate positively with neutrophil count and diastolic blood pressure) may serve as biological marker for development of prehypertension, hypertension, and ultimately cardiovascular diseases.
24349153 TNFalpha signals via p66(Shc) to induce E-Selectin, promote leukocyte transmigration and enhance permeability in human endothelial cells.
24266503 Bereaved respondents had higher levels of inflammatory biomarkers IL-6 and sE-selectin, but not CRP and sICAM-I than the non-bereaved.
24260191 meta-analysis suggested that the SELE gene polymorphisms (A561C, G98T) were significantly associated with increased risk of CAD.
24249306 Results indicate that the individuals bearing AC genotype of E-selectin gene polymorphism (S128R) are more prone to stroke than AA genotype.
24151105 Results show a lack of a direct association between SELE rs5355C>T gene polymorphism, serum PAPP-A level and intima-media thickness in patients with end-stage renal disease.
23988228 Endothelial injury may play a role in the pathogenesis of CMBs, and serum levels of adiponectin and sE-selectin were closely related to CMBs.
23929007 Ectopic expression of alphaB-crystallin increases TNF-alpha induced expression of E-selectin.
23906304 High E-selectin expression is associated with high endothelial activation and breast cancer.
23855486 acacetin inhibits the expression of E-selectin by regulation of the p38 MAPK signaling pathway and activation of NF-kappaB.
23772946 first report to link inheritance of A allele, AA and AC genotypes of the E-selectin rs5361 polymorphism with increased risk of RAS.
23623010 Genetic variants at the ABO locus independently affect sE-selectin level in Taiwanese subjects.
23565284 E-selectin mediated adhesion and migration of endothelial colony forming cells is enhanced by SDF-1alpha/CXCR4.
23457623 TWEAK acted as an inducer of E-selectin and ICAM-1 expression in mice with cutaneous vasculitis and human dermal microvascular endothelial cells
23442851 In contrast to P- and L-selectin, the E-selectin/PSGL-1 binding does not exhibit significant changes at acidic pH levels, as shown both experimentally and computationally.
23403989 ICAM1, VCAM1 and E-selectin were downregulated through HMGB1 interference in HUVECs, and HMGB1 shRNA decreased E-selectin expression by HOXA9.
23353989 Intratumoral vascular E-selectin, critical for T-cell entry into skin, was downregulated in the majority of Merkel cell cancers, and its loss was associated with poor intratumoral CD8 lymphocyte infiltration.
23242661 ICAM1 K469E and E-selectin S128R polymorphisms could predispose to increased autoantibody production and TSH suppression in Graves' disease.
23235150 beta(3)-adrenergic stimulation acts through up-regulation of E-selectin in adipose tissue endothelial cells to induce neutrophil infiltration
23190470 The associations of SELE genotypes/haplotypes with sE-selectin levels are affected by MMP9 levels in Taiwanese individuals.
23187956 Data suggest that plasma E-selectin and leptin can be down-regulated by dietary changes; soy protein supplementation appears to reduce plasma levels of E-selectin and leptin.
23129313 SDF-1-3'A confers increased susceptibility to breast cancer and that the E-selectin S128R CC genotype may be related to poorer prognosis.
23041613 Constitutively expressed E-selectin on endothelial cells in the proliferating phase is one mediator of the stem cell tropism in infantile hemangioma.
23015400 The E-selectin S128R C allele may confer an increased susceptibility to gastric cancer development and correlate with a poor prognosis.
22970241 breast cancer cells express Mac-2BP as a novel E-selectin ligand, potentially revealing a new prognostic and therapeutic target for breast cancer
22922984 In the E-selectin +G98T polymorphism and the +A561C polymorphism, The levels of HBV DNA and preS1Ag in the AC genotype patients were higher than those in the AA genotype.
22836626 study found a progressive increase in the concentrations of E-selectin, P-selectin and L-selectin with severity of obstructive sleep apnea (OSA); level of plasma adhesion molecules may be indicative of OSA severity and may contribute to cardiovascular sequelae
22820001 Data indicate that sLex microspheres tether to 4 h IL-1beta-treated umbilical vein endothelial cells (HUVEC) primarily through E-selectin.
22815813 rs6046A allele in F7 associated with decreased blood pressure levels (P</=3.7x10(-3)) and rs5355T allele in SELE associated with decreased diastolic blood pressure levels.
22814396 A correlation exists between sialofucosylated PODXL expression and enhanced binding to selectins by metastatic pancreatic cancer cells.
22763042 Data show in pulmonary microvascular endothelial cells (HPMECs), unfractionated heparin (UFH) significantly attenuated LPS-induced production of IL-1beta, IL-6, E-selectin and ICAM-1, as well as phosphorylation of p38 MAPK and NF-kappaB translocation.
22718118 Our results suggest that local production of NO in squamous cell carcinomas may impair vascular E-selectin expression.
22648254 Ser 128Arg of E-selectin and the K469E of ICAM-1 polymorphisms may be involved in predisposition to atherosclerosis.
22593709 Results indicate that there might be no correlation between pseudoexfoliation syndrome (PEX) and such endothelial cell markers as von Willebrand antigen (vWF Ag), E-selectin, and P-selectin concentrations
22589243 Our current study demonstrates that the E-selectin ingle-nucleotide polymorphisms A561C is associated with increased risk for the development of ischemic stroke in this subset of the Han Chinese population.
22533155 E-selectin is synthesized by the endothelium after the activation of inflammatory cytokines such as interleukin-1 and tumor necrosis factor-alpha in coronary disease. [review]
22508864 These results suggest that the interaction between host E-selectin and pathogen Pgm6/7 mediates Porphyromonas gingivalis adherence to endothelial cells and may trigger vascular inflammation.
22497223 Data suggest blood levels of E-selectin, VCAM-1/vascular cell adhesion molecule-1, and ICAM-1/intercellular adhesion molecule-1 have inverse association with blood tetrahydrobiopterin/dihydrobiopterin ratio of normotensive type 2 diabetic patients.
22414298 no association was detected between these SELE polymorphisms and the prevalence of Kawasaki disease or the development of coronary artery lesions
22384091 analysis of shear stress modulation of IL-1beta-induced E-selectin expression in human endothelial cells
22366582 The results indicate that E- and P-selectins play a role in spontaneous metastasis formation both into bone marrow and lungs
22336504 The immunohistochemical expressions of PECAM-1 and E-selectin were significantly increased at intima in vulnerable plaques of acute coronary syndrome patients. E-selectin Ser128Arg polymorphism is associated with ACS.
22322211 Report preparation of E-selectin-targeting nanoparticles functionalized with an analog of sialyl Lewis X.
22271244 E-selectin confers selectivity and efficiency of signaling for extravasation at sites of inflammation
22269951 HOXA9 is required for TNF-alpha-dependent binding of PRMT5 to the E-selectin promoter in endothelial cells.
22264805 Protective effect of cilostazol against neointimal hyperplasia may be mediated by its anti-inflammatory actions of mononuclear cells homing to endothelial cells by decreasing SLX and E-selectin expression.
22159147 Data indicate that MUC16 immunopurified from pancreatic cancer cells efficiently binds E- and L- but not P-selectin.
22158116 Our results indicate that the common variant rs5361 of the E-selectin gene is strongly associated with essential hypertensino in Han individuals and weakly associated in Uygur individuals.
22104155 The Ser128Arg polymorphism might confer an increased susceptibility to breast cancer and contribute to aggressive phenotypic characteristics.
22068558 Data suggest that up-regulation of plasma selectins (selectin E, selectin L, and selectin P) may represent novel mechanism of aldosterone-mediated development/progression of atherosclerosis.
22030423 E-selectin was detected in the wall of all the aneurysm tissue samples and was rarely found in normal control arteries by immunohistochemistry, and it was concentrated in proliferating and disorganized epithelia cells.
22025563 Data show that only ZR-75-1 cells could adhere to activated endothelial cells under dynamic flow conditions in a sLe(x) and E-selectin-dependent manner.
22021370 Studies indicate that PSGL-1, CD44, and ESL-1 on mature leukocytes are physiologic glycoprotein ligands for endothelial P-selectin and E-selectin.
22010135 Genetic variations at the ABO locus are associated with circulating levels of ICAM1, P-selectin, and E-selectin.
22009003 These results demonstrate that in hereditary angioedema, the majority of endothelial functions are normal during inter-attack periods; however, soluble E-selectin levels are elevated.
21881522 examined polymorphisms in three genes (ATP1B1, RGS5 and SELE) in relation to hypertension and blood pressure in a cohort of African-Americans
21827804 Postoperative platelet activation is related to the E-selectin S149R polymorphism, which enhances the risk of adverse events after CABG
21780194 Data suggest that E-selectin variant rs5361 and FCGR2A variant rs1801274 were significantly associated with gastric cancer risk.
21756793 C602A and T1559C polymorphisms of SELE are associated with essential hypertension in the Chinese population, and T1559C is closely related with hypertension in males but not females.
21659524 E-selectin up-regulation stimulated by macrophages may play an active role in atherogenesis in the high glucose condition
21629188 Associations between the C1901T and G2692A E-selectin polymorphisms and coronary artery disease in the Polish population were found.
21544708 findings implicate that adhesion of SCLC cells to E-selectin is of paramount importance in SCLC metastasis formation
21526496 serum concentrations of sE-selectin and IL-18 in type 1 diabetic patients with and without microangiopathy
21521525 SELP, but not SELE or SELL, are risk factors for age-related macular degeneration; sporadic or rare mutations in SELE, SELL, or SELP may have a role in the pathogenesis of AMD
21486700 The aim of the study was to evaluate and compare the circulating concentrations of OPN, E-selectin and END of severely obese patients with metabolic syndrome before and after vertical banded gastroplasty.
21471547 Data show that the baseline levels of both vWF and sES were higher in the patients with PHPT, while at the 6-month follow-up, vWF decreased significantly and sES was normal.
21381877 high circulating levels of maternal endothelial dysfunction markers soluble E-selectin. vascular cell adhesion molecule 1, and fms-like tyrosine kinase 1 present in pre-eclampsia are associated with decreased nitric oxide synthesis in fetal endothelium
21286681 During septic shock, patients with diabetes had higher levels of circulating biomarkers of endothelial cell adhesion (E-selectin) and VEGF signalling (sFLT-1).
21162967 Increased levels of VCAM-1 and ICAM-1, E-selectin and P-selectin, as markers of inflammation, showed the importance of inflammatory processes in the development of atherosclerosis and clinical expression of CAD.
21159528 Homocysteine treated endothelial cells showed significantly increased expression of E-selectin.
21138731 CD40/CD40L interaction induces E-selectin dependent adhesion of leukocytes to human endothelial cells and reduces endothelial cell migration by inhibiting the Akt/eNOS signaling pathway.
21099224 This study showed a coexpression of E-selectin and VCAM-1 in endothelial cells in early and recurrent appendicitis. In patients with symptoms for less than 6 h, only E-selectin was detected.
20941749 genetic association studies between one E-selectin SNP and childhood ischemic stroke in Polish subjects: evidence did not confirm the relationship between the 98G>T polymorphism of E-selectin gene and childhood ischemic stroke
20941749 Observational study of gene-disease association. (HuGE Navigator)
20937831 indoxyl sulfate enhances leukocyte-endothelial interactions through up-regulation of E-selectin, presumably via the JNK- and NF-kappaB-dependent pathway
20855565 Observational study of gene-disease association. (HuGE Navigator)
20833389 Cell adhesion and cell rolling on the blood vessel wall were simulated by perfusing cancer cells through microtubes coated with recombinant human E-selectin
20796317 Hypertensive patients and normotensive subjects were significantly different with respect to the genotypes CC, CA and AA and the C-allele frequency of C602A.
20796317 Observational study of gene-disease association. (HuGE Navigator)
20713000 A triphasic force dependence of E-selectin/ligand dissociation that initially behaves as slip bonds, then transitions to catch bonds, and finally transitions again to slip bonds as the force increases.
20691427 Observational study of gene-disease association. (HuGE Navigator)
20680929 Elevated C-reactive protein and soluble E-selectin were associated with higher HOMA-IR among residents of Inner Mongolia.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20656374 Variation in intracellular sphingosine-1-phosphate concentrations may represent a novel mechanism of fine-tuning the expression of proinflammatory and atherogenic E-selectin cell adhesion molecule by vascular endothelial cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20622166 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20607758 E-selectin S128R "C" allele may confer an increased susceptibility to pancreatic cancer development, while its carriage status does not appear to be related to the aggressive features of this malignancy.
20607758 Observational study of gene-disease association. (HuGE Navigator)
20603037 Observational study of gene-disease association. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20587315 E-selectin, ICAM-1 and their ligands are important molecules of hepatocellular carcinoma and endothelial cells to tumor adhesive metastasis.
20580062 Letter: E-selectin was not found in amniotic fluid but was found in cord blood.
20536507 Observational study of gene-disease association. (HuGE Navigator)
20508517 Observational study of gene-disease association. (HuGE Navigator)
20495539 Aberrant expression of selectin E, CXCL1, and CXCL13 occurs in chronic endometritis.
20485444 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20445017 Human neutrophil rolling on E- or P-selectin induces the extended alpha(L)beta(2) integrin conformation through signaling triggered by PSGL-1 engagement.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20430730 Results suggest that serum concentrations of sICAM, sVCAM and sE-selectin can reflect tumor progression and metastasis.
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20227257 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20193033 Data show a significant decrease in L-selectin and increased E-selectin and ICAM-1 expression in HH patients.
20191078 Two primers were used for detection of ICAM (K469E) allelic polymorphisms are given in Table 1.
20191078 Observational study of gene-disease association. (HuGE Navigator)
20056442 The authors found a dose-related association between the 98T E-selectin polymorphism and bleeding after cardiac surgery, independent of and additive to standard clinical risk factors
20056442 Observational study of gene-disease association. (HuGE Navigator)
20044088 plasma soluble E-selectin and adiponectin are associated with carotid plaque in patients with systemic lupus erythematosus
20010946 E- and P-selectins have a crucial role in spontaneous metastasis formation.
20004427 The results suggest that high serum concentrations of sE-selectin can predict cardiovascular events in Japanese patients with type 2 diabetes mellitus
19996987 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19949084 E-selectin and ICAM-1 are targets of TNF-induced miRNAs miR-31 and miR-17-3p, respectively.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19942746 Results document the status of S128R polymorphism of E-selectin gene in angiographically proven coronary artery disease (CAD) patients.
19942746 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19885579 E-selectin is upregulated in umbilical vein endothelial cells by anticancer drugs and inhibited by cimetidine
19729612 E-selectin levels have been associated with the ABO blood group phenotype.
19729601 Observational study of gene-disease association. (HuGE Navigator)
19701669 Soluble E-selectin levels were not changed in patients with asthma exacerbation.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19670701 Expression of selectins (E and L) was detected mainly in the skin leukocytes in all biopsy samples of dermatitis herpetiformis and bullous pemphigoid.
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19564823 Plasma E-selectin and soluble ICAM1 levels were significantly higher in the TT or TC genotype compared to that of the CC genotype.
19559392 Observational study of gene-disease association. (HuGE Navigator)
19548631 The levels of E-selectin, ICAM-1, IL-11, IRF-1, IL-6, IL-1beta and LIF genes expression in the B. pseudomallei-infected cells were 1.5-5 times lower than in the B. thailandensis-infected cells.
19538882 Galectin-9 isoforms regulate the E-selectin expression in LoVo cells differently and thus influence the adhesion between LoVo cells and HUVECs in vitro in different modes.
19536175 Observational study of gene-disease association. (HuGE Navigator)
19479237 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19422386 The carbon monoxide releasing molecule (CORM-3) inhibits expression of vascular cell adhesion molecule-1 and E-selectin independently of haem oxygenase-1 expression.
19420919 E-selectin S128R and L554F polymorphisms are associated with susceptibility to ischemic stroke.
19420919 Observational study of gene-disease association. (HuGE Navigator)
19420105 Observational study of gene-disease association. (HuGE Navigator)
19417018 Data show that clinical outcomes of inoperable breast cancer were predicted by changes in VCAM-1 and E-selectin.
19414551 The cag pathogenicity island was found to be an important determinant for the upregulation of human endothelial E-selectin expression in vitro, and this process is probably dependent on the CagL protein, mediating binding to alpha5beta1 integrins.
19361981 The S128R polymorphism is a constitutional factor associated with a higher risk of relapse and death in patients treated for colorectal cancer.
19361981 Observational study of gene-disease association. (HuGE Navigator)
19263529 Observational study of gene-disease association. (HuGE Navigator)
19249917 Obesity did not alter E-selectin expression in adipose tissue.
19240957 Despite the fact that selectins play a role in the pathogenesis of MS and their encoding genes are located in regions associated with the disease, the selectin gene cluster studied likely does not influence the susceptibility to MS in Caucasians.
19240957 Observational study of gene-disease association. (HuGE Navigator)
19238444 HuGE review of gene-disease association and gene-environment interaction. (HuGE Navigator)
19237221 Serum and intraocular concentrations of ICAM-1, VCAM-1, E-selectin, vWF were considerably higher in the subjects with proliferative diabetic retinopathy than in the controls.
19225544 Observational study of gene-disease association. (HuGE Navigator)
19212205 No significant differences in allele or genotype frequencies were observed for ICAM-1 K469E, E-selectin, and PECAM-1 polymorphisms between Ulcerative Colitis patients, Crohn Ddisease patients, and controls.
19212205 Observational study of gene-disease association. (HuGE Navigator)
19191721 data suggest that the A561C polymorphism of the E-selectin gene may be associated with disease progression in patients with chronic HBV infection
19191721 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19139603 In recently diagnosed hypertensive subjects, hsCRP and sE-selectin levels are related to awake systolic blood pressure variability.
19136145 There was a significant correlation between E-selectin and ICAM1 in all patients.
19131662 Meta-analysis of gene-disease association. (HuGE Navigator)
19118161 Podocalyxin-like protein is an E-/L-selectin ligand on colon carcinoma cells: comparative biochemical properties of selectin ligands in host and tumor cells.
19064610 Observational study of gene-disease association. (HuGE Navigator)
19056482 Observational study of gene-disease association. (HuGE Navigator)
19028820 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19021457 Neither amniotic fluic ELAM-1 (endothelial leukocyte adhesion molecule 1) nor VCAM-1 (vascular cell adhesion molecule 1)levels correlated with cervical dilatation or with the duration of labor
18991188 Changes in nailfold capillaroscopy, endothelial cell activation markers (VEGF, endothelin-1, E-selectin, and thrombomodulin) and features of systemic lupus erythematosus suggest microvascular abnormalities in the clinical manifestation of the disease.
18974842 Observational study of gene-disease association. (HuGE Navigator)
18974840 Observational study of gene-disease association. (HuGE Navigator)
18973547 There was significant difference in the Ser128Arg polymorphism of E-selectin between periodontal patients and controls. There was an association between the presence of the 128Arg allele and periodontitis.
18973547 Observational study of gene-disease association. (HuGE Navigator)
18930765 Plasma levels are increased after induction of endotoxemia with E.coli LPS
18828734 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18794336 Data suggest that squamous cell carcinomas evade the immune response at least in part by down-regulating vascular E-selectin and recruiting regulatory T cells.
18791689 correlations found between sVCAM-1, sICAM-1 and sELAM-1 and the presence of retinopathy suggest that cellular adhesion and neovascularization may be linked processes
18761727 Angiostatin K1-3 induced E-selectin expression via AP1 and Ets-1 binding to the proximal E-selectin promoter (-356/+1), which was positively mediated by JNK activation.
18726101 serum E-selectin correlated with severity of joint disease in rheumatoid arthritis patients
18710415 Over-expression of PPARalpha or PPARgamma attenuates Tat-induced up-regulation of inflammatory mediators, such as interleukin (IL)-1beta, tumor necrosis factor-alpha, CCL2, and E-selectin
18707907 Gb3 induces oxidative stress and up-regulates the expression of ICAM1, VACAM1 and selectin E in Fabry disease vascular endothelial cells.
18704886 Elevated serum sE-selectin was associated with a poor outcome of biliary atresia and probably plays a role in the physiopathology of liver injury in postoperative biliary atresia.
18692491 VEGF, sVCAM-1, sICAM-1 and sE-selectin median levels were higher in hemodialysis patients compared to controls.
18677293 Levels of E-selectin positively correlated with high triglyceride levels in type 2 diabetic subjects with silent ischemia.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18649056 Study points to synergistic interactions between 561A > C or 98G > T polymorphisms of E-selectin gene and hypercholesterolemia that cause a significant increase in the susceptibility to coronary artery disease.
18633131 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18613029 NF-kappaB, but not p38, is critical for TNF-alpha-induced expression of ICAM-1, VCAM-1 and E-selectin
18611928 These findings suggested that E-selectin and Sialyl Lewis X might play an important role in lymph node metastasis in invasive micropapillary carcinoma.
18597952 Report maspin, E-selectin, and P-selectin expressions in papillary thyroid carcinomas and their correlation with prognostic parameters.
18597403 Patients with inactive TA have elevated levels of sE-selectin, sVCAM-1, and sICAM-1 that might indicate persistent vasculopathy in clinically inactive disease.
18593916 E-selectin regulates diapedesis of circulating cancer cells.
18590706 Oxidized LDL impairs angiogenic properties of endothelial progenitor cells at sub-apoptotic levels by downregulation of E-selectin and integrin alphavbeta5, both substantial mediators of EPC-endothelial cell interaction.
18580442 Suggest that E-selectin levels could be useful in the early assessment of the severity of acute pancreatitis.
18513389 Observational study of gene-disease association. (HuGE Navigator)
18484695 Higher serum concentrations of endothelin-1 (ET-1), E-selectin, and Thrombomodulin were observed in SLE patients in comparison with controls
18401566 Transient expression of galectin-9L decreased E-selectin levels, while transient expression of galectin-9M or galectin-9S increased E-selectin levels in LoVo cells.
18375392 CEA and CD44v cooperate to mediate colon carcinoma cell adhesion to E- and L-selectin at elevated shear stresses.
18276775 Over-expression of PPARalpha or PPARgamma attenuates Tat-induced up-regulation of inflammatory mediators, such as interleukin (IL)-1beta, tumor necrosis factor-alpha, CCL2, and E-selectin
18217430 soluble E-selectin and soluble P-selectin in blood plasma of labouring women do not appear to have a role in preeclampsia
18212564 Xenon, isoflurane, nitrous oxide, and morphine do not prevent TNF-alpha induced E-selectin expression.
18197885 Mean sICAM-1 value was higher in patients with active giant cell arteritis than in cluster headache patients during the active cluster period.
18191640 Data show that P-selectin, but not L- or E-selectin, concentrations are significantly increased in male and female pseudoxanthoma elasticum patients.
18191640 Observational study of gene-disease association. (HuGE Navigator)
18182036 Observational study of gene-disease association. (HuGE Navigator)
18094708 A significant association of E-selectin and susceptibility to Graves' disease is found in a Chinese population.
18094708 Observational study of gene-disease association. (HuGE Navigator)
18029551 E-selectin clusters in both clathrin-coated pits and lipid rafts of endothelial cells but is internalized in clathrin-coated pits.
18020971 Observational study of gene-disease association. (HuGE Navigator)
17996280 Endothelial dysfunction exists in atrial fibrillation and is related to dysfuncion of E selectin levels.
17991470 Acetylcholine-induced vasodilation in the forearm, but not flow mediated vasodilation, was inversely related to CRP and e-selectin levels independently of traditional risk factors in elderly subjects
17963163 Increased blood levels in rheumatoid arthritis are diminished after treatment with methotrexate.
17956423 This is the first report of a leptospiral protein capable of up-regulating the expression of endothelial cell adhesion molecules ICAM-1 and E-selectin.
17954174 Observational study of gene-disease association. (HuGE Navigator)
17939599 E-selectin Serl28Arg polymorphism is not associated with the risk of severe preeclampsia.
17875185 data are in keeping with the hypothesis that in systemic inflammation altered E-selectin shedding may play a role in arterial damage & implicates this adhesion molecule in atherosclerotic complications in a high-risk condition like end-stage renal disease
17706953 OPG but not OPN stimulated a dose-dependent increase in the expression of intercellular adhesion molecule-1, vascular cell adhesion molecule-1 and E-selectin by endothelial cells in the presence of TNF-alpha
17706337 In women with subsequent preeclampsia, sL-selectin and sVCAM-1 concentrations were significantly lower, whereas sE-selectin, sP-selectin and sICAM-1 levels were significantly higher, compared with controls at mid-pregnancy (p<0.05).
17684030 study demonstrates that the functional counter-receptors for E-selectin at the cell surface of Colo201 human colon cancer cells are localized in detergent-insoluble membrane microdomains (DIM).
17578587 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17578587 the risk of acquiring coronary artery disease in patients with type 2 diabetes mellitus increases significantly in the presence of the 128R mutant allele of the E-selectin gene
17563404 Observational study of gene-disease association. (HuGE Navigator)
17515951 Data show that in bullous pemphigoid, expression of E selectins was detected mainly in basal keratinocytes and in inflammatory infiltrates in the dermis.
17452460 HOXA9 participates in the transcriptional activation of SELE in endothelial cells.
17392035 These results suggest that the Arg/Arg genotype of the E-selectin gene polymorphism in codon 128 is a genetic factor that may determine an individual's susceptibility for brucella infection.
17389327 higher levels of E-selectin and ICAM-1 were consistently associated with increased diabetes risk in a multiethnic cohort of U.S. postmenopausal women, implicating an etiological role of endothelial dysfunction in the pathogenesis of type 2 diabetes.
17372905 Observational study of gene-disease association. (HuGE Navigator)
17372905 These findings suggest that the E-selectin S128R polymorphism can functionally affect tumor-endothelial interactions as well as motility and signaling properties of neoplastic cells that may modulate the metastatic phenotype.
17167725 Increased plasma levels of E-selectin is associated with advanced stage of breast cancer
17143564 The periprocedural evaluation of sP-selectin and sE-selectin in peripheral venous blood in patients undergoing elective coronary stenting provides no prognostic information in terms of clinical restenosis prediction.
17142773 HOSCN induces E-selectin, ICAM-1, and VCAM-1 expression in HUVEC; HOSCN up-regulation of these adhesion molecules is transcriptionally mediated through a mechanism dependent upon activation of NFKB and constitutively suppressed by PI3K-Akt pathway.
17057786 Observational study of gene-disease association. (HuGE Navigator)
17057786 We were not able to demonstrate an association between the Hemicentin-1, hOgg1, and E-selectin SNPs and age-related macular degeneration development in the currently available cases and controls.
17036337 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17020471 Observational study of gene-disease association. (HuGE Navigator)
17014013 Observational study of gene-disease association. (HuGE Navigator)
17014013 The sE-selectin, rheumatoid factor, and erythrocyte sedimentation rate, in addition to clinical indices, were associated with clinical activity in rheumatoid arthritis.
16982492 Observational study of gene-disease association. (HuGE Navigator)
16980970 G-CSF has a role in the induction of E-selectin ligands on myeloid cells, thus providing mechanistic insight into the pathobiology of G-CSF complications
16974056 Observational study of gene-disease association. (HuGE Navigator)
16974056 The interval was significantly longer in IgA nephropathy patients with a homoallele of C in C1402T, C1402/C1402, of the E-selectin gene, or a homoallele of C in C712T, C712/C712, of the L-selectin gene compared to others.
16963035 Tibolone causes a rapid and sustained decrease in circulating levels of VCAMs; the effect is lost soon after stopping the treatment.
16916660 Observational study of genotype prevalence. (HuGE Navigator)
16916660 A significant increase in allele frequencies of 128R of E-selectin and the associated genotype SR was observed in celiac disease patients.
16908800 Observational study of gene-disease association. (HuGE Navigator)
16908800 Homozygosity for the S128R E-selectin allele appears to increase the risk for recurrent venous thromboembolism several fold.
16892455 E-selectin immunoadhesin decreases leukocyte attachment and rolling in vitro.
16843446 Observational study of gene-disease association. (HuGE Navigator)
16843446 Our results show that E-selectin gene polymorphisms represent an increased risk for ischemic CVD in the Japanese population without diabetes mellitus and hypercholesterolemia.
16820586 Observational study of gene-disease association. (HuGE Navigator)
16773720 Serum E-selectin, ICAM-1 and integrin beta1 expression levels are probably related to the metastasis and relapse of gastric cancer.
16756647 Observational study of gene-disease association. (HuGE Navigator)
16756647 The mutant 128R allele of the E-selectin gene is associated with angiographic severe coronary artery disease (CAD) in Saudi Arabs. This association is lost after adjustment for traditional CAD risk factors.
16722397 secretion and expression of E-selectin in nasal polyps increase significantly
16565092 expression of HCELL confers robust and predominant tumor cell binding to E- and L-selectin
16554320 Observational study of gene-disease association. (HuGE Navigator)
16554320 in end-stage renal disease, the Leu554Phe polymorphism of E-selectin gene is associated with the severity of carotid atherosclerosis
16544732 Observational study of gene-disease association. (HuGE Navigator)
16501492 Hepatocyte growth factor ameliorates acute renal inflammation in part by downregulating E-selectin mediated macrophage adhesion to the inflamed endothelium.
16433632 Tethering by E-selectin triggers b2-integrin-dependent adhesion and a b2-integrin-dependent outside-in signal resulting in tyrosine phosphorylation of a 110 kDa protein, in human PMN.
16426244 Observational study of gene-disease association. (HuGE Navigator)
16269612 CD43 is a T-cell E-selectin ligand distinct from PSGL-1 which expands the role of CD43 in the regulation of T-cell trafficking.
16080806 The E-selectin A561C (S128R) polymorphism might affect blood pressure in Chinese.
16080806 Observational study of gene-disease association. (HuGE Navigator)
16061120 Observational study of gene-disease association. (HuGE Navigator)
16061120 SR genotype of the E-selectin gene polymorphism in codon 128 is a genetic factor that may determine an individual's susceptibility for CAD in Chinese.
16002039 Observational study of gene-disease association. (HuGE Navigator)
15979159 Observational study of gene-disease association. (HuGE Navigator)
15917220 FBI-1 enhances transcription of the NF-kappaB-responsive E-selectin gene by nuclear localization of the p65 subunit of NF-kappaB
15871853 Observational study of genotype prevalence. (HuGE Navigator)
15833936 Observational study of gene-disease association. (HuGE Navigator)
15833936 conclude that the E-selectin variants examined are not important genetic risk factors for type 2 diabetes in women
15784173 Genomic rearrangement on SELE in arteriosclerosis was studied.
15736116 concluded that in conjunction with serum triglycerides and serum leptin, serum E-selectin is another important independent factor associated with insulin resistance in nonobese Japanese type 2 diabetic patients
15666579 Direct implication of adhesion molecules in the pathogenesis or progression of type 2 diabetic retinopathy cannot be supported.
15593054 In myeloperoxidase-ANCA-positive microscopic polyangiitis, higher sICAM-1 and sELAM-1 levels during active phase and their slower decline during treatment period could be prognostic risk factor for chronic renal failure.
15584003 Observational study of genotype prevalence. (HuGE Navigator)
15560890 Cell expression in response to tobacco smoke extract.
15515123 Increases in serum E-selectin is associated with rheumatoid arthritis
15488708 CLA and E-selectin are bound by T cells and have roles in skin inflammation
15387376 role of E-selectin in activating integrins to modulate adhesion and regulate integrin-mediated events
15331359 Clustered monocyte cell adhesion correlated with endothelial cells coexpressing intercellular adhesion molecule-1 (ICAM-1) and E-selectin as result of a flow-induced, selective upregulation of E-selectin expression in a subset of ICAM-1-expressing cells.
15308783 Observational study of gene-disease association. (HuGE Navigator)
15304054 ICAM-1, VCAM-1, E-selectin and interleukin-6 expression are enhanced by glucose and regulated by poly(ADP-ribose) polymerase in human umbilical endothelial cells
15299021 the orientation and length of P-selectin, E-selectin, or CD16A receptor influences its rate of encountering and binding a surface ligand but does not subsequently affect the stability of binding
15254658 sE-selectin may have a role in progression and metastasis of colorectal neoplasms
15194470 Over-expression of PPARalpha or PPARgamma attenuates Tat-induced up-regulation of inflammatory mediators, such as interleukin (IL)-1beta, tumor necrosis factor-alpha, CCL2, and E-selectin
15187162 E-selectin is unique among selectins in its capacity for clustering sialylated ligands and transducing signals leading to neutrophil arrest in shear flow.
15179350 Observational study of gene-disease association. (HuGE Navigator)
15179350 Our study suggests that the E-selectin polymorphism may be associated with severity of atherosclerotic disease, but does not allow us to conclude that it is actually a risk factor for atherosclerosis.
15167972 IVIG inhibits NF-kappaB activation induced by TNF-alpha in cultured endothelial cells of coronary arteries, thereby possibly modulating IL-6 production and E-selectin expression
15148373 E-selectin is required for the antiangiogenic activity of endostatin in vivo and ex vivo and confers endostatin sensitivity to nonresponsive human endothelial cells in vitro
15086468 The severity and diversity of the histopathology of lupus nephritis are partially associated with the expression of E-selectin, P-selectin, and VCAM-1 in glomeruli.
15083893 Observational study of gene-disease association. (HuGE Navigator)
15083893 The C allele at the +561 position of the E-selectin gene is associated with significantly reduced risk of developing sarcoidosis in patients with erythema nodosum.
15080580 E-selectin may play an important inflammation-related role in plaque development.
15076188 Observational study of gene-disease association. (HuGE Navigator)
15076188 These results suggest a BMI-specific effect of L/F554 polymorphism of the E-selectin gene on blood pressure, and strengthen the hypothesis that E-selectin is implicated in hypertension.
15076187 Observational study of gene-disease association. (HuGE Navigator)
15013273 Observational study of gene-disease association. (HuGE Navigator)
15009098 Expresson is reduced in treatment with methotrexate in bullous pemphigoid.
14988223 E-selectin has a role in tumor cell adhesion but its expression is inhibited by lovastatin and all-trans retinoic acid
14984317 even a short-term exposure of endothelial cells (ECs) to high glucose concentration leads to their activation associated with increased expression of adhesion molecules such as ELAM-1, VCAM-1 and ICAM-1.
14763917 Data indicate that weight loss is more important than glycaemic control in regulating circulating levels of E-selectin in morbidly obese subjects.
14734737 Coexpression of E-selectin with ICAM-1 and CCL17 on blood vessels in noninflamed skin provides the basis for a model of cutaneous immunosurveillance system active in the absence of pathologic inflammation.
14714557 minor trauma to skin may induce expression of E-selectin, ICAM-1 and IL-8
14691583 Observational study of gene-disease association. (HuGE Navigator)
14607629 E-selectin and its ligand-sLeX are closely correlated with the metastasis of hepatocellular carcinoma
14592840 E-selectin has a role in promoting growth inhibition and apoptosis of human and murine hematopoietic progenitor cells independent of PSGL-1
14587643 Observational study of gene-disease association. (HuGE Navigator)
14557872 Observational study of gene-disease association. (HuGE Navigator)
14534081 Adrenomedullin and ACTH induce cell surface expression of adhesion molecules E-selectin, VCAM-1, and ICAM-1 on human umbilical vein endothelial cells.
12960351 Localization of E-selectin in lipid rafts is necessary for its association with, and activation of, phospholipase C gamma.
12940514 Blood levels do not differ in normal and coronary artery disease patients.
12898464 central obese subjects with concomitant higher levels of selectin E and ACE DD genotype may be characterized by early cardiovascular alterations and then considered a particular subset of subjects at higher risk of cardiovascular disease
12871600 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
12820726 The adhesion of E-selectin expressing CHO cells to the coated mucins was analyzed in a flow system revealing that the MUC1 mucin adhered better than the CD43 mucin
12792758 High serum soluble E-selectin levels are associated with postoperative haematogenic recurrence in esophageal squamous cell carcinoma
12788528 Extravasated and oxidized LDL in xanthoma adds to foam cell recruitment by activating tyrosine kinase and inducing adhesion of monocytes to dermal microvascular endothelial cells through VCAM-1 and E-selectin.
12768436 Observational study of genotype prevalence. (HuGE Navigator)
12738381 interacts with Helicobacter pylori isolates from patients with chronic gastritis, duodenal ulcer and gastric cancer
12698264 Enhanced expression of E-selectin on the vascular endothelium of peripheral nerve in critically ill patients with neuromuscular disorders.
12673844 Endothelial cells have increased expression of VCAM-1, E-selectin, and ICAM-1 when exposed to sickle blood cells.
12649084 Observational study of gene-disease association. (HuGE Navigator)
12649084 The E-selectin Ser128Arg polymorphism can functionally alter leukocyte-endothelial interactions as well as biochemical and biological consequences, which may account for the pathogenesis of myocardial infarction.
12595908 Observational study of gene-disease association. (HuGE Navigator)
12522014 is a potent mediator of human dermal microvascular endothelial cell (HMVEC) chemotaxis, which is predominantly mediated through the Src and the phosphatidylinositiol 3-kinase (PI3K) pathways
12499405 interacts with fuco-oligosaccharides of the blood group family
12421968 A serine to arginine (S128R) polymorphism in E-selectin extends the range of lymphocytes recruited by E-selectin, which may provide a mechanistic link between this polymorphism and vascular inflammatory disease.
12388172 enhanced expression of E-selectin may contribute to the development of diabetic maculopathy in type 2 diabetes
12200386 Conjunctival biopsies excised from patients following cataract surgery did not show that endothelial E-selectin might play a role in the surgery-induced up-regulation of leukocyte rolling.
12200076 Observational study of gene-disease association. (HuGE Navigator)
12186696 circulating soluble selectin E in acute myeloid leukemia is correlated with peripheral blast cell counts, extramedullaary infiltration, relapse and mortality
12175121 Observational study of gene-disease association. (HuGE Navigator)
12172576 Downregulation of e-selectin is associated with nodal metastasis in breast cancer
12172318 E-selectin, intercellular adhesion molecule-1 (ICAM-1), and vascular adhesion molecule-1 (VCAM-1) were measured in serum from hypertensive patients with LV hypertrophy
12165498 CD62L on human cultured T lymphoblasts is one of several glycoproteins that interacts directly with E-selectin and contributes to rolling under flow.
12086338 the preferential expression of selectin E on the endothelium of femoral and iliac arteries in thromboangiitis obliterans
12082592 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12082590 Observational study of gene-disease association. (HuGE Navigator)
12036529 Observational study of gene-disease association. (HuGE Navigator)
12027924 Observational study of gene-disease association. (HuGE Navigator)
12020443 X-irradiation 2-5 h before stimulation decreased the characteristic transient expression of E-selectin after TNFalpha stimulation.
12011765 E-selectin blood levels are no different in non-Hodgkin's lymphoma patients and controls
11981814 Eosinophil interaction with endothelial P-selectin is far more important than interaction with E-selectin for recruitment into the inflamed skin of patients with atopic dermatitis.
11948013 inhibition of cytokine induction of promoter by 17beta-estradiol
11936588 results showed that sP-selectin and sE-selectin levels were higher in patients with lung cancer compared to normal donors; increased levels of sP-selectin and sE-selectin were associated with squamous lung cancer at late stages but not adenocarcinoma
11935152 relation between glycemic control, hyperinsulinism and plasma concentration in patints with glucose intolerance or NIDDM
11929779 Human mast cell progenitors use alpha4-integrin, VCAM-1, and PSGL-1, E-selectin for adhesive interactions with human vascular endothelium under flow conditions
11882337 E-selectin and vWF were not correlated with percent body fat, but were negatively correlated with M (r= -0.65 and -0.46, both P<0.001) and positively correlated with CRP (r=0.46, and 0.33, both P<0.05).
11859093 role of phosphoserine-type di-leucine motif in E-selectin internalization
11847011 significant increase in plasma levels between day 1 and day 5 of G-CSF-induced stem cell mobilization; possible effect on leukocyte-endothelial cell interactions
11828340 Observational study of gene-disease association. (HuGE Navigator)
11828340 two SNPs in the E-selectin gene and six SNPs in the L-selectin gene were significantly associated with IgAN in Japanese patients
11827962 activation of expression by HIV-1 tat protein via NF-kappa B-dependent mechanism
11827962 Over-expression of PPARalpha or PPARgamma attenuates Tat-induced up-regulation of inflammatory mediators, such as interleukin (IL)-1beta, tumor necrosis factor-alpha, CCL2, and E-selectin
11776680 Premature labor is associated with up-regulation of adhesion molecules in the lower uterine segment
11764211 Observational study of gene-disease association. (HuGE Navigator)
11764211 The e-selectin C allele was more common in systemic lupus erythematosus than in controls. E-selectin may be a susceptibility gene to systemic lupus erythematosus in these populations.
11714857 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11697721 circadian variations in healthy adults and in subjects with type II diabetes; possible role in increased vascular wall uptake of lipoproteins in diabetic subjects
11575218 Observational study of gene-disease association. (HuGE Navigator)
11575217 Observational study of gene-disease association. (HuGE Navigator)
11466561 Observational study of gene-disease association. (HuGE Navigator)
11359462 Observational study of gene-disease association. (HuGE Navigator)
11341749 Observational study of genotype prevalence. (HuGE Navigator)
11168027 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11097335 Observational study of gene-disease association. (HuGE Navigator)
10477700 Over-expression of PPARalpha or PPARgamma attenuates Tat-induced up-regulation of inflammatory mediators, such as interleukin (IL)-1beta, tumor necrosis factor-alpha, CCL2, and E-selectin
9597096 Over-expression of PPARalpha or PPARgamma attenuates Tat-induced up-regulation of inflammatory mediators, such as interleukin (IL)-1beta, tumor necrosis factor-alpha, CCL2, and E-selectin
9269771 Over-expression of PPARalpha or PPARgamma attenuates Tat-induced up-regulation of inflammatory mediators, such as interleukin (IL)-1beta, tumor necrosis factor-alpha, CCL2, and E-selectin
7693046 Over-expression of PPARalpha or PPARgamma attenuates Tat-induced up-regulation of inflammatory mediators, such as interleukin (IL)-1beta, tumor necrosis factor-alpha, CCL2, and E-selectin
7523444 Over-expression of PPARalpha or PPARgamma attenuates Tat-induced up-regulation of inflammatory mediators, such as interleukin (IL)-1beta, tumor necrosis factor-alpha, CCL2, and E-selectin

AA Sequence 

MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYY      1 - 70
WIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYT     71 - 140
AACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISC    141 - 210
DRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMG    211 - 280
AQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECT    281 - 350
TQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDN    351 - 420
EKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQV    421 - 490
VKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPLVAG    491 - 560
LSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESDGSYQKPSYIL                        561 - 610
//

Text Mined References (405)

PMID Year Title
26988221 2016 Inhibition of E-selectin expression on the surface of endothelial cells inhibits hepatocellular carcinoma growth by preventing tumor angiogenesis.
26937892 2016 Relationship of SELE A561C and G98T Variants With the Susceptibility to CAD.
26872904 2016 High-density lipoprotein of patients with breast cancer complicated with type 2 diabetes mellitus promotes cancer cells adhesion to vascular endothelium via ICAM-1 and VCAM-1 upregulation.
26868209 2016 Glycosphingolipids on Human Myeloid Cells Stabilize E-Selectin-Dependent Rolling in the Multistep Leukocyte Adhesion Cascade.
26828984 2016 The E-selectin S149R polymorphisms in breast cancer in a northern Iran population.
26617843 2015 Role of E-selectin for diagnosis of myocardial injury in children of age up to 14 years.
26396484 2015 Glaucomatous MYOC mutations activate the IL-1/NF-?B inflammatory stress response and the glaucoma marker SELE in trabecular meshwork cells.
26329844 2015 Distinct kinetic and mechanical properties govern mucin 16- and podocalyxin-mediated tumor cell adhesion to E- and L-selectin in shear flow.
26153406 2016 A critical role for ATF2 transcription factor in the regulation of E-selectin expression in response to non-endotoxin components of Neisseria meningitidis.
26124272 2015 Quantitative Characterization of E-selectin Interaction with Native CD44 and P-selectin Glycoprotein Ligand-1 (PSGL-1) Using a Real Time Immunoprecipitation-based Binding Assay.
26116870 2015 Circulating endothelial cell number and markers of endothelial dysfunction in previously preeclamptic women.
26051909 2015 E-selectin and P-selectin expression in endothelium of leprosy skin lesions.
25939768 2015 E-selectin expression induced by Porphyromonas gingivalis in human endothelial cells via nucleotide-binding oligomerization domain-like receptors and Toll-like receptors.
25787250 2015 Neomorphic effects of recurrent somatic mutations in Yin Yang 1 in insulin-producing adenomas.
25748737 2015 Associations SELE gene haplotype variant and hypertension in Mongolian and Han populations.
25498912 2015 ST3Gal-4 is the primary sialyltransferase regulating the synthesis of E-, P-, and L-selectin ligands on human myeloid leukocytes.
25424718 2015 Associations of Endothelial System Genes With Blood Pressure Changes and Hypertension Incidence: The GenSalt Study.
25345762 2015 A case-control study on proinflammatory genetic polymorphisms on sudden sensorineural hearing loss.
25238218 2014 Novel cardiovascular biomarkers in women with a history of early preeclampsia.
25201247 2015 Palmitate-stimulated monocytes induce adhesion molecule expression in endothelial cells via IL-1 signaling pathway.
25171839 2015 E-selectin gene polymorphism (A561C) and essential hypertension. Meta-analysis in the Chinese population.
25168603 2014 E-selectin gene (S128R) polymorphism in hemorrhagic stroke: comparison with ischemic stroke.
25147432 2014 Assessment of the E-selectin rs5361 (561A>C) polymorphism and soluble protein concentration in acute coronary syndrome: association with circulating levels.
25138157 2014 Melanoma upregulates ICAM-1 expression on endothelial cells through engagement of tumor CD44 with endothelial E-selectin and activation of a PKC?-p38-SP-1 pathway.
25003340 2014 E-selectin gene polymorphisms and essential hypertension in Asian population: an updated meta-analysis.
25002508 2014 G-CSF induces membrane expression of a myeloperoxidase glycovariant that operates as an E-selectin ligand on human myeloid cells.
25000467 2014 Increased soluble selectins as a reflection of activated platelets and endothelium in Legg-Calve-Perthes disease.
24995349 2014 Immune imbalance in nasal polyps of Caucasian chronic rhinosinusitis patients is associated with a downregulation of E-selectin.
24980946 2014 Pharmacogenetic predictors of outcome in patients with stage II and III colon cancer treated with oxaliplatin and fluoropyrimidine-based adjuvant chemotherapy.
24820735 2014 CD144(+)EMPs/CD62E(+)EMPs: a couple of new biomarkers to monitor endothelial function in hypertension with hyperlipidemia involved.
24815478 2014 E-selectin S128R polymorphism is associated with cancer risk: a meta-analysis.
24798295 2015 Soluble L-Selectin as an Independent Biomarker of Bronchial Asthma.
24699516 2014 Selectins mediate small cell lung cancer systemic metastasis.
24690766 2014 Cell density impacts epigenetic regulation of cytokine-induced E-selectin gene expression in vascular endothelium.
24688092 2014 Implications of the E-selectin S128R mutation for drug discovery.
24627030 2015 Relationship of late arteriovenous fistula stenosis with soluble E-selectin and soluble EPCR in chronic hemodialysis patients with arteriovenous fistula.
24558466 2014 Association of biomarkers of inflammation with dyslipidemia and its components among Mongolians in China.
24534074 2014 Diet quality and markers of endothelial function: the CARDIA study.
24516598 2014 Serum adhesion molecule levels as prognostic markers in patients with early systemic sclerosis: a multicentre, prospective, observational study.
24498435 2014 Heterogeneous effect of two selectin gene polymorphisms on coronary artery disease risk: a meta-analysis.
24457076 2014 Intercellular adhesion molecule 1/2 and E-selectin in plasma cell mastitis: immunohistochemical study of 35 cases.
24418879 2013 Plasma sE-selectin level is positively correlated with neutrophil count and diastolic blood pressure in Japanese men.
24349153 2013 TNF? signals via p66(Shc) to induce E-Selectin, promote leukocyte transmigration and enhance permeability in human endothelial cells.
24266503 2015 The association between bereavement and biomarkers of inflammation.
24260191 2013 Association of A561C and G98T polymorphisms in E-selectin gene with coronary artery disease: a meta-analysis.
24249306 2014 Association of E-selectin gene polymorphism (S128R) with ischemic stroke and stroke subtypes.
24151105 2014 Association of E-selectin gene polymorphism and serum PAPP-A with carotid atherosclerosis in end-stage renal disease.
23988228 2013 Microbleeds in ischemic stroke are associated with lower serum adiponectin and higher soluble E-selectin levels.
23929007 2013 ?B-crystallin/HspB5 regulates endothelial-leukocyte interactions by enhancing NF-?B-induced up-regulation of adhesion molecules ICAM-1, VCAM-1 and E-selectin.
23906304 2013 Endotelial activation and flow-mediated vasodilation in young patients with breast cancer.
23855486 2013 Acacetin inhibits expression of E-selectin on endothelial cells through regulation of the MAP kinase signaling pathway and activation of NF-?B.
23772946 2013 Association of cell adhesion molecule gene polymorphisms with recurrent aphthous stomatitis.
23623010 2013 Mediation analysis reveals a sex-dependent association between ABO gene variants and TG/HDL-C ratio that is suppressed by sE-selectin level.
23565284 2013 E-selectin mediated adhesion and migration of endothelial colony forming cells is enhanced by SDF-1?/CXCR4.
23457623 2013 TWEAK enhances E-selectin and ICAM-1 expression, and may contribute to the development of cutaneous vasculitis.
23442851 2013 Effect of extracellular pH on selectin adhesion: theory and experiment.
23403989 2013 shRNAs targeting high-mobility group box-1 inhibit E-selectin expression via homeobox A9 in human umbilical vein endothelial cells.
23353989 2013 Vascular E-selectin expression correlates with CD8 lymphocyte infiltration and improved outcome in Merkel cell carcinoma.
23242661 2013 ICAM1 K469E and E-selectin S128R polymorphisms could predispose to increased autoantibody production and TSH suppression in Graves' disease.
23235150 2013 ?3-Adrenergic receptor stimulation induces E-selectin-mediated adipose tissue inflammation.
23190470 2012 Association of SELE genotypes/haplotypes with sE-selectin levels in Taiwanese individuals: interactive effect of MMP9 level.
23187956 2013 Effect of soybean protein on novel cardiovascular disease risk factors: a randomized controlled trial.
23129313 2013 The impact of the stromal cell-derived factor-1-3'A and E-selectin S128R polymorphisms on breast cancer.
23041613 2012 E-selectin mediates stem cell adhesion and formation of blood vessels in a murine model of infantile hemangioma.
23015400 2013 E-Selectin S128R gene polymorphism in gastric cancer.
22970241 2012 Mac-2 binding protein is a novel E-selectin ligand expressed by breast cancer cells.
22922984 2012 Association between polymorphisms of the E-selectin gene, hepatitis B virus DNA copies and preS1 antigen in patients with chronic hepatitis B infection.
22836626 2013 Plasma selectins in patients with obstructive sleep apnea.
22820001 2012 HECA-452 is a non-function blocking antibody for isolated sialyl Lewis x adhesion to endothelial expressed E-selectin under flow conditions.
22815813 2012 Functional epistatic interaction between rs6046G>A in F7 and rs5355C>T in SELE modifies systolic blood pressure levels.
22814396 2012 Sialofucosylated podocalyxin is a functional E- and L-selectin ligand expressed by metastatic pancreatic cancer cells.
22763042 2012 Unfractionated heparin inhibits lipopolysaccharide-induced inflammatory response through blocking p38 MAPK and NF-?B activation on endothelial cell.
22718118 2012 Nitric oxide-producing myeloid-derived suppressor cells inhibit vascular E-selectin expression in human squamous cell carcinomas.
22648254 2012 Genetic variations in E-selectin and ICAM-1: relation to atherosclerosis.
22593709 2012 Endothelial cell markers in patients with pseudoexfoliation syndrome.
22589243 2012 Association of E-selectin gene polymorphisms with ischemic stroke in a Chinese Han population.
22533155 2011 [Role of the polymorphisms within genes encoding proteins related to endothelial dysfunction in coronary artery disease].
22508864 2012 E-selectin mediates Porphyromonas gingivalis adherence to human endothelial cells.
22497223 2012 Association between the levels of circulating adhesion molecules and biopterins in type-2 diabetic normotensive patients adhesion molecules and biopterins.
22414298 2012 Lack of an association between E-selectin gene polymorphisms and risk of Kawasaki disease.
22384091 2012 Shear stress modulation of IL-1?-induced E-selectin expression in human endothelial cells.
22366582 2012 Selectin-deficiency reduces the number of spontaneous metastases in a xenograft model of human breast cancer.
22336504 2011 [PECAM-1 and E-selectin expression in vulnerable plague and their relationships to myocardial Leu125Val polymorphism of PECAM-1 and Ser128Arg polymorphism of E-selectin in patients with acute coronary syndrome].
22322211 2012 Preparation of E-selectin-targeting nanoparticles and preliminary in vitro evaluation.
22271244 2012 E-selectin ligands as mechanosensitive receptors on neutrophils in health and disease.
22269951 2012 HOXA9 methylation by PRMT5 is essential for endothelial cell expression of leukocyte adhesion molecules.
22264805 2012 Cilostazol suppression of arterial intimal hyperplasia is associated with decreased expression of sialyl Lewis X homing receptors on mononuclear cells and E-selectin in endothelial cells.
22159147 2012 Mucin 16 is a functional selectin ligand on pancreatic cancer cells.
22158116 2012 A common missense single nucleotide polymorphism in the E-selectin gene is significantly associated with essential hypertension in the Han population but only weakly associated in the Uygur population.
22104155 2011 Polymorphic variant Ser128Arg of E-Selectin is associated with breast cancer risk and high grade tumors.
22068558 2011 Relationship between plasma aldosterone concentration and soluble cellular adhesion molecules in patients referred to coronary angiography.
22030423 2011 E-selectin expression increased in human ruptured cerebral aneurysm tissues.
22025563 2011 Selectin ligand sialyl-Lewis x antigen drives metastasis of hormone-dependent breast cancers.
22021370 2011 Leukocyte ligands for endothelial selectins: specialized glycoconjugates that mediate rolling and signaling under flow.
22010135 2011 Association of variation at the ABO locus with circulating levels of soluble intercellular adhesion molecule-1, soluble P-selectin, and soluble E-selectin: a meta-analysis.
22009003 2012 Endothelial cell function in patients with hereditary angioedema: elevated soluble E-selectin level during inter-attack periods.
21881522 2011 Association of ATP1B1, RGS5 and SELE polymorphisms with hypertension and blood pressure in African-Americans.
21827804 2011 Effect of the E-selectin gene polymorphism (S149R) on platelet activation and adverse events after coronary artery surgery.
21780194 2012 E-selectin rs5361 and FCGR2A rs1801274 variants were associated with increased risk of gastric cancer in a Chinese population.
21756793 2011 [Association of C602A and T1559C polymorphisms of E-selectin gene and essential hypertension].
21659524 2011 High glucose-treated macrophages augment E-selectin expression in endothelial cells.
21629188 2011 Low frequency haplotypes of E-selectin polymorphisms G2692A and C1901T give increased protection from coronary artery disease.
21544708 2011 Adhesion of small cell lung cancer cells to E- and P-selectin under physiological flow conditions: implications for metastasis formation.
21526496 2011 Microvascular abnormalities in capillaroscopy correlate with higher serum IL-18 and sE-selectin levels in patients with type 1 diabetes complicated by microangiopathy.
21521525 2011 Evaluation of variants in the selectin genes in age-related macular degeneration.
21486700 2011 Systemic blood osteopontin, endostatin, and E-selectin concentrations after vertical banding surgery in severely obese adults.
21471547 Endothelial activation markers soluble E-selectin and von Willebrand factor in primary hyperparathyroidism.
21381877 2011 Fetal endothelium dysfunction is associated with circulating maternal levels of sE-selectin, sVCAM1, and sFlt-1 during pre-eclampsia.
21286681 2011 Influence of diabetes on endothelial cell response during sepsis.
21162967 2010 Levels of soluble adhesion molecules in patients with various clinical presentations of coronary atherosclerosis.
21159528 2011 Chronic homocysteine exposure upregulates endothelial adhesion molecules and mediates leukocyte: endothelial cell interactions under flow conditions.
21138731 2011 CD40/CD40L interaction induces E-selectin dependent leukocyte adhesion to human endothelial cells and inhibits endothelial cell migration.
21099224 2010 Expression of E-selectin and vascular cell adhesion molecule-1 in so-called 'negative' appendices: first results to support the pathological diagnosis in borderline cases.
20941749 2010 Association analysis of the E-selectin 98G?>?T polymorphism and the risk of childhood ischemic stroke.
20937831 2010 Indoxyl sulfate induces leukocyte-endothelial interactions through up-regulation of E-selectin.
20855565 2010 Common genetic variation in multiple metabolic pathways influences susceptibility to low HDL-cholesterol and coronary heart disease.
20833389 2010 Knockdown of fucosyltransferase III disrupts the adhesion of circulating cancer cells to E-selectin without affecting hematopoietic cell adhesion.
20796317 2010 E-selectin gene polymorphisms are associated with essential hypertension: a case-control pilot study in a Chinese population.
20713000 2010 Triphasic force dependence of E-selectin/ligand dissociation governs cell rolling under flow.
20691427 2010 Genetic associations of brain structural networks in schizophrenia: a preliminary study.
20680929 2010 Biomarkers of inflammation, endothelial dysfunction and insulin resistance in adults of Inner Mongolia, China.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20656374 2010 Sphingosine 1-phosphate (S1P) induces expression of E-selectin and adhesion of monocytes via intracellular signalling pathways in vascular endothelial cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20622166 2010 Combined effect of inflammatory gene polymorphisms and the risk of ischemic stroke in a prospective cohort of subjects with type 2 diabetes: a Go-DARTS study.
20607758 2010 Analysis of E-Selectin S128R gene polymorphism in pancreatic cancer.
20603037 2010 Single nucleotide polymorphisms in inflammation-related genes are associated with venous thromboembolism.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20587315 2010 [Effects of E-selectin and their ligands on the adhesive metastasis of hepatocellular carcinoma].
20580062 2011 Selectins in human amniotic fluid and cord blood plasma. A preliminary report.
20536507 2010 Independent predictive roles of eotaxin Ala23Thr, paraoxonase 2 Ser311Cys and beta-adrenergic receptor Trp64Arg polymorphisms on cardiac disease in Type 2 Diabetes--an 8-year prospective cohort analysis of 1297 patients.
20508517 2010 Increased serum vWF and sVCAM-1 levels are associated with late or very late angiographic stent thrombosis after sirolimus-eluting stent implantation.
20495539 2010 Aberrant expression of selectin E, CXCL1, and CXCL13 in chronic endometritis.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20445017 2010 Rolling on E- or P-selectin induces the extended but not high-affinity conformation of LFA-1 in neutrophils.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20430730 2009 Serum sICAM, sVCAM and sE-selectin levels in colorectal cancer patients.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20227257 2011 Polymorphisms in the platelet-specific collagen receptor GP6 are associated with risk of nonfatal myocardial infarction in Caucasians.
20193033 2010 Highly sensitivity adhesion molecules detection in hereditary haemochromatosis patients reveals altered expression.
20191078 2010 Role of ICAM-1 and E-selectin gene polymorphisms in pathogenesis of PAOD in Egyptian patients.
20056442 2010 Association of the 98T ELAM-1 polymorphism with increased bleeding after cardiac surgery.
20044088 2010 Association of plasma soluble E-selectin and adiponectin with carotid plaque in patients with systemic lupus erythematosus.
20010946 2010 E-/P-selectins and colon carcinoma metastasis: first in vivo evidence for their crucial role in a clinically relevant model of spontaneous metastasis formation in the lung.
20004427 2010 Soluble adhesion molecule E-selectin predicts cardiovascular events in Japanese patients with type 2 diabetes mellitus.
19996987 2010 Blood pressure response to potassium supplementation is associated with genetic variation in endothelin 1 and interactions with E selectin in rural Chinese.
19949084 2010 Cutting edge: TNF-induced microRNAs regulate TNF-induced expression of E-selectin and intercellular adhesion molecule-1 on human endothelial cells: feedback control of inflammation.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19942746 2009 Genetic predisposition of E-selectin gene (S128R) polymorphism in patients with coronary artery disease (CAD).
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19885579 2009 Increase in E-selectin expression in umbilical vein endothelial cells by anticancer drugs and inhibition by cimetidine.
19729612 2009 Genome-wide association identifies the ABO blood group as a major locus associated with serum levels of soluble E-selectin.
19729601 2009 Candidate gene polymorphisms for ischemic stroke.
19701669 Soluble intercellular adhesion molecule-1 and E-selectin in patients with asthma exacerbation.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19670701 2009 Expression of selected adhesion molecules in dermatitis herpetiformis and bullous pemphigoid.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19564823 2009 Influence of genetic polymorphisms in oxidative stress related genes and smoking on plasma MDA-LDL, soluble CD40 ligand, E-selectin and soluble ICAM1 levels in patients with coronary artery disease.
19559392 2009 A candidate gene association study of 77 polymorphisms in migraine.
19548631 2009 Differential gene expression profiles of lung epithelial cells exposed to Burkholderia pseudomallei and Burkholderia thailandensis during the initial phase of infection.
19538882 2009 [Galectin-9 isoforms influence the adhesion between colon carcinoma LoVo cells and human umbilical vein endothelial cells in vitro by regulating the expression of E-selectin in LoVo cells].
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19479237 2009 Phenotype-genotype interactions on renal function in type 2 diabetes: an analysis using structural equation modelling.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19422386 2009 The carbon monoxide releasing molecule (CORM-3) inhibits expression of vascular cell adhesion molecule-1 and E-selectin independently of haem oxygenase-1 expression.
19420919 2009 E-selectin genetic variation as a susceptibility factor for ischemic stroke.
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19417018 2009 A vasculature-targeting regimen of preoperative docetaxel with or without bevacizumab for locally advanced breast cancer: impact on angiogenic biomarkers.
19414551 2009 Selective upregulation of endothelial E-selectin in response to Helicobacter pylori-induced gastritis.
19361981 2009 E-selectin gene S128R polymorphism is associated with poor prognosis in patients with stage II or III colorectal cancer.
19263529 2009 Genetic risk factors in recurrent venous thromboembolism: A multilocus, population-based, prospective approach.
19249917 2010 The influence of obesity and different fat depots on adipose tissue gene expression and protein levels of cell adhesion molecules.
19240957 2009 Candidate gene analysis of selectin cluster in patients with multiple sclerosis.
19238444 2009 The genomic basis of cerebral palsy: a HuGE systematic literature review.
19237221 2009 Proliferative diabetic retinopathy-The influence of diabetes control on the activation of the intraocular molecule system.
19225544 2009 Variation in the lymphotoxin-alpha/tumor necrosis factor locus modifies risk of erythema nodosum in sarcoidosis.
19212205 2009 Polymorphism in ICAM-1, PECAM-1, E-selectin, and L-selectin genes in Tunisian patients with inflammatory bowel disease.
19191721 2009 Polymorphisms and plasma soluble levels of E-selectin in patients with chronic hepatitis B virus infection.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19139603 2008 Awake blood pressure variability, inflammatory markers and target organ damage in newly diagnosed hypertension.
19136145 2009 Does colorectal cancer clinical advancement affect adhesion molecules (sP-selectin, sE-selectin and ICAM-1) concentration?
19131662 2009 A meta-analysis of candidate gene polymorphisms and ischemic stroke in 6 study populations: association of lymphotoxin-alpha in nonhypertensive patients.
19118161 2009 Podocalyxin-like protein is an E-/L-selectin ligand on colon carcinoma cells: comparative biochemical properties of selectin ligands in host and tumor cells.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
19028820 2009 Polymorphisms in inflammatory genes and the risk of ischemic stroke and transient ischemic attack: results of a multilocus genotyping assay.
19021457 2009 Amniotic fluid adhesion molecules during parturition at term.
18991188 Clinical significance of nailfold capillaroscopy in systemic lupus erythematosus: correlation with endothelial cell activation markers and disease activity.
18974842 2008 Gender differences in genetic risk profiles for cardiovascular disease.
18974840 2008 Identification of novel single nucleotide polymorphisms in inflammatory genes as risk factors associated with trachomatous trichiasis.
18973547 2009 E-selectin and L-selectin polymorphisms in patients with periodontitis.
18930765 2008 Differential dose-dependent effects of prednisolone on shedding of endothelial adhesion molecules during human endotoxemia.
18828734 2008 Adhesion molecule polymorphisms and pulse wave velocity in American youth.
18794336 2008 Human squamous cell carcinomas evade the immune response by down-regulation of vascular E-selectin and recruitment of regulatory T cells.
18791689 2008 Blood serum levels of vascular cell adhesion molecule (sVCAM-1), intercellular adhesion molecule (sICAM-1) and endothelial leucocyte adhesion molecule-1 (ELAM-1) in diabetic retinopathy.
18761727 2008 Angiostatin K1-3 induces E-selectin via AP1 and Ets1: a mediator for anti-angiogenic action of K1-3.
18726101 2009 Circulating E-selectin and tumor necrosis factor-alpha in extraarticular involvement and joint disease activity in rheumatoid arthritis.
18707907 2008 Globotriaosylceramide induces oxidative stress and up-regulates cell adhesion molecule expression in Fabry disease endothelial cells.
18704886 2008 Elevated serum soluble E-selectin is associated with poor outcome and correlated with serum ALT in biliary atresia.
18692491 2008 Evaluation of circulating vascular endothelial growth factor and soluble adhesion molecules as reliable predictors of native arteriovenous fistula thrombosis in chronic hemodialysis patients.
18677293 2008 Levels of adhesion molecules bear a relationship to triglyceride levels in type 2 diabetic subjects with proven silent ischemia.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18649056 2008 Synergistic effects between 561A > C and 98G > T polymorphisms of E-selectin gene and hypercholesterolemia in determining the susceptibility to coronary artery disease.
18633131 2008 Host immune gene polymorphisms in combination with clinical and demographic factors predict late survival in diffuse large B-cell lymphoma patients in the pre-rituximab era.
18613029 2008 NF-kappaB, but not p38 MAP kinase, is required for TNF-alpha-induced expression of cell adhesion molecules in endothelial cells.
18611928 2010 E-selectin and Sialyl Lewis X expression is associated with lymph node metastasis of invasive micropapillary carcinoma of the breast.
18606703 2008 Endoglycan, a member of the CD34 family of sialomucins, is a ligand for the vascular selectins.
18597952 2008 Maspin, E-selectin, and P-selectin expressions in papillary thyroid carcinomas and their correlation with prognostic parameters.
18597403 2008 Soluble endothelial cell adhesion molecules and their relationship to disease activity in Takayasu's arteritis.
18593916 2008 Mechanisms by which E-selectin regulates diapedesis of colon cancer cells under flow conditions.
18590706 2008 Oxidized low density lipoprotein impairs endothelial progenitor cell function by downregulation of E-selectin and integrin alpha(v)beta5.
18580442 2008 Serum adhesion molecules in acute pancreatitis: time course and early assessment of disease severity.
18513389 2008 New application of intelligent agents in sporadic amyotrophic lateral sclerosis identifies unexpected specific genetic background.
18484695 2008 Clinical significance of selected endothelial activation markers in patients with systemic lupus erythematosus.
18401566 2009 Different roles of galectin-9 isoforms in modulating E-selectin expression and adhesion function in LoVo colon carcinoma cells.
18375392 2008 Carcinoembryonic antigen and CD44 variant isoforms cooperate to mediate colon carcinoma cell adhesion to E- and L-selectin in shear flow.
18217430 2007 The selectins E and P in normal labour. A preliminary report on evaluation of their prognostic values for preeclampsia.
18212564 2008 Intermitted pharmacologic pretreatment by xenon, isoflurane, nitrous oxide, and the opioid morphine prevents tumor necrosis factor alpha-induced adhesion molecule expression in human umbilical vein endothelial cells.
18197885 2008 Comparison of soluble ICAM-1, VCAM-1 and E-selectin levels in patients with episodic cluster headache and giant cell arteritis.
18191640 2008 Circulating P-, L- and E-selectins in pseudoxanthoma elasticum patients.
18182036 2008 Selectin haplotypes and the risk of venous thrombosis: influence of linkage disequilibrium with the factor V Leiden mutation.
18094708 2008 The common variants of E-selectin gene in Graves' disease.
18029551 2008 Clustering endothelial E-selectin in clathrin-coated pits and lipid rafts enhances leukocyte adhesion under flow.
18020971 2008 Genetic profiling in healthy subjects from the Stanislas cohort based on 24 polymorphisms: effects on biological variables.
17996280 2008 Impaired flow mediated dilatation as evidence of endothelial dysfunction in chronic atrial fibrillation: relationship to plasma von Willebrand factor and soluble E-selectin levels.
17991470 2008 C-reactive protein and e-selectin levels are related to vasodilation in resistance, but not conductance arteries in the elderly: the prospective investigation of the Vasculature in Uppsala Seniors (PIVUS) study.
17963163 Soluble cell adhesion molecules (sICAM-1, sVCAM-1, and sE-selectin) in patients with early rheumatoid arthritis.
17956423 2007 A novel leptospiral protein increases ICAM-1 and E-selectin expression in human umbilical vein endothelial cells.
17954174 2007 Adhesion molecule polymorphisms in acute renal allograft rejection.
17939599 2007 Ser128Arg E-selectin and Thr715Pro P-selectin polymorphisms and severe preeclampsia.
17875185 2007 Circulating E-selectin as a risk marker in patients with end-stage renal disease.
17706953 2007 Osteoprotegerin upregulates endothelial cell adhesion molecule response to tumor necrosis factor-alpha associated with induction of angiopoietin-2.
17706337 2008 Adhesion molecules changes at 20 gestation weeks in pregnancies complicated by preeclampsia.
17684030 2007 A cholesterol-independent membrane microdomain serves as a functional counter-receptor for E-selectin at the Colo201 cell surface and initiates signalling on E-selectin binding.
17578587 2007 The interactive role of type 2 diabetes mellitus and E-selectin S128R mutation on susceptibility to coronary heart disease.
17563404 2007 E-selectin S128R polymorphism leads to severe asthma.
17515951 2007 Expression of selected integrins and selectins in bullous pemphigoid.
17452460 2007 HOXA9 participates in the transcriptional activation of E-selectin in endothelial cells.
17392035 2007 The Ser128Arg polymorphism for E-selectin gene and brucellosis.
17389327 2007 Circulating levels of endothelial adhesion molecules and risk of diabetes in an ethnically diverse cohort of women.
17372905 2007 Role of S128R polymorphism of E-selectin in colon metastasis formation.
17167725 2006 Soluble VCAM-1 and E-selectin in breast cancer: relationship with staging and with the detection of circulating cancer cells.
17143564 2007 Periprocedural soluble P- and E-selectin levels fail as predictors of clinical restenosis in patients treated with elective coronary stenting.
17142773 2006 Thiocyanate-dependent induction of endothelial cell adhesion molecule expression by phagocyte peroxidases: a novel HOSCN-specific oxidant mechanism to amplify inflammation.
17057786 2005 Analysis of Hemicentin-1, hOgg1, and E-selectin single nucleotide polymorphisms in age-related macular degeneration.
17036337 2006 Risks of human limb deficiency anomalies associated with 29 SNPs of genes involved in homocysteine metabolism, coagulation, cell-cell interactions, inflammatory response, and blood pressure regulation.
17020471 2006 Different genes and polymorphisms affecting high-density lipoprotein cholesterol levels in Greek familial hypercholesterolemia patients.
17014013 2006 sE-Selectin expression and A561C polymorphism in relation to rheumatoid arthritis clinical activity.
16982492 2006 Selectin polymorphisms and perinatal morbidity in low-birthweight infants.
16980970 2006 G-CSF induces E-selectin ligand expression on human myeloid cells.
16974056 2006 Impact of selectin gene polymorphisms on rapid progression to end-stage renal disease in patients with IgA nephropathy.
16963035 2006 Long-term effects of tibolone on circulating levels of vascular cell adhesion molecules and E-selectin in postmenopausal women.
16916660 2006 Polymorphism in L-selectin, E-selectin and ICAM-1 genes in Asian Indian pediatric patients with celiac disease.
16908800 2006 Homozygosity in the single nucleotide polymorphism Ser128Arg in the E-selectin gene associated with recurrent venous thromboembolism.
16892455 Human soluble E-selectin immunoadhesin inhibits leukemic monocyte adhesion to endothelial cells.
16843446 2006 A561C polymorphism of E-selectin is associated with ischemic cerebrovascular disease in the Japanese population without diabetes mellitus and hypercholesterolemia.
16820586 2006 Inflammatory gene polymorphisms and risk of postoperative myocardial infarction after cardiac surgery.
16773720 2006 Expression of E-selectin, integrin beta1 and immunoglobulin superfamily member in human gastric carcinoma cells and its clinicopathologic significance.
16756647 2006 E-selectin S128R polymorphism and severe coronary artery disease in Arabs.
16722397 2006 [Secretion and expression of E-selectin in nasal polyps].
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16565092 2006 HCELL is the major E- and L-selectin ligand expressed on LS174T colon carcinoma cells.
16554320 2006 The E-selectin gene polymorphism and carotid atherosclerosis in end-stage renal disease.
16544732 2006 Candidate gene polymorphism in cardiovascular disease: the BIP cohort.
16501492 2006 Hepatocyte growth factor suppresses acute renal inflammation by inhibition of endothelial E-selectin.
16433632 2006 Src-family kinases mediate an outside-in signal necessary for beta2 integrins to achieve full activation and sustain firm adhesion of polymorphonuclear leucocytes tethered on E-selectin.
16426244 2006 Association between ICAM-1 Gly-Arg polymorphism and renal parenchymal scarring following childhood urinary tract infection.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16269612 2006 CD43 is a ligand for E-selectin on CLA+ human T cells.
16080806 2005 [Effect of E-selectin A561C (S128R) polymorphism on blood pressure].
16061120 2005 Association between the Ser128Arg variant of the E-selectin and risk of coronary artery disease in the central China.
16002039 2005 Plasmodium falciparum malaria in south-west Nigerian children: is the polymorphism of ICAM-1 and E-selectin genes contributing to the clinical severity of malaria?
15979159 2005 E-selectin A561C and G98T polymorphisms influence susceptibility and course of multiple sclerosis.
15917220 2005 FBI-1 enhances transcription of the nuclear factor-kappaB (NF-kappaB)-responsive E-selectin gene by nuclear localization of the p65 subunit of NF-kappaB.
15871853 2005 Circulating soluble E-selectin levels and the Ser 128Arg polymorphism in individuals from different ethnic groups.
15833936 2005 E-selectin genotypes and risk of type 2 diabetes in women.
15784173 Genomic rearrangements on VCAM1, SELE, APEG1and AIF1 loci in atherosclerosis.
15736116 2005 Soluble E-selectin, leptin, triglycerides, and insulin resistance in nonobese Japanese type 2 diabetic patients.
15666579 2004 Soluble adhesion molecules are not involved in the development of retinopathy in type 2 diabetic patients.
15593054 Circulating levels of soluble adhesion molecules in patients with ANCA-associated vasculitis.
15584003 2004 [Distribution of E-selectin gene polymorphism in the Zhuangs and Hans of Guangxi province in China].
15560890 2004 Extracts from cigarette smoke induce DNA damage and cell adhesion molecule expression through different pathways.
15515123 Serum E-selectin and erythrocyte membrane Na+K+ ATPase levels in patients with rheumatoid arthritis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15488708 2004 In vivo evidence for close association of CLA expression and E-selectin binding by T cells in the inflamed skin.
15387376 2004 Adhesion of HT-29 colon carcinoma cells to endothelial cells requires sequential events involving E-selectin and integrin beta4.
15331359 2005 Flow-conditioned HUVECs support clustered leukocyte adhesion by coexpressing ICAM-1 and E-selectin.
15308783 2004 Proinflammatory genetic profiles in subjects with history of ischemic stroke.
15304054 2004 Intermittent high glucose enhances ICAM-1, VCAM-1, E-selectin and interleukin-6 expression in human umbilical endothelial cells in culture: the role of poly(ADP-ribose) polymerase.
15299021 2004 Quantifying the effects of molecular orientation and length on two-dimensional receptor-ligand binding kinetics.
15254658 2004 Serum levels of soluble E-selectin in colorectal cancer.
15187162 2004 Shear-dependent capping of L-selectin and P-selectin glycoprotein ligand 1 by E-selectin signals activation of high-avidity beta2-integrin on neutrophils.
15179350 2004 Ser128Arg gene polymorphism for E-selectin and severity of atherosclerotic arterial disease.
15167972 2004 An immunoglobulin agent (IVIG) inhibits NF-kappaB activation in cultured endothelial cells of coronary arteries in vitro.
15148373 2004 E-selectin is required for the antiangiogenic activity of endostatin.
15086468 2004 Endothelial adhesion molecules in glomerular lesions: association with their severity and diversity in lupus models.
15083893 E-selectin polymorphism in erythema nodosum secondary to sarcoidosis.
15080580 2004 Expression of endothelial protein C receptor and thrombomodulin in human coronary atherosclerotic plaques.
15076188 2004 The Leu554Phe polymorphism in the E-selectin gene is associated with blood pressure in overweight people.
15076187 2004 Genetic influences on blood pressure within the Stanislas Cohort.
15013273 2003 The E-selectin S128R polymorphism is not a risk factor for coronary artery disease in patients with diabetes mellitus type 2.
15009098 2004 Altered tissue expression pattern of cell adhesion molecules, ICAM-1, E-selectin and VCAM-1, in bullous pemphigoid during methotrexate therapy.
14988223 2004 Ionizing radiation-induced E-selectin gene expression and tumor cell adhesion is inhibited by lovastatin and all-trans retinoic acid.
14984317 2004 Effect of high glucose concentrations on expression of ELAM-1, VCAM-1 and ICAM-1 in HUVEC with and without cytokine activation.
14763917 2004 Body weight and glucose metabolism have a different effect on circulating levels of ICAM-1, E-selectin, and endothelin-1 in humans.
14734737 2004 E-selectin, thymus- and activation-regulated chemokine/CCL17, and intercellular adhesion molecule-1 are constitutively coexpressed in dermal microvessels: a foundation for a cutaneous immunosurveillance system.
14714557 2003 Increased E-selectin, IL-8 and IL-10 gene expression in human skin after minimal trauma.
14691583 2004 E-Selectin and restenosis after femoropopliteal angioplasty: prognostic impact of the Ser128Arg genotype and plasma levels.
14607629 2002 E-selectin and its ligand-sLeX in the metastasis of hepatocellular carcinoma.
14592840 2004 Adhesion to E-selectin promotes growth inhibition and apoptosis of human and murine hematopoietic progenitor cells independent of PSGL-1.
14592723 2003 L-selectin and E-selectin expressed on monocytes mediating Ehrlichia chaffeensis attachment onto host cells.
14587643 2003 Association study of CD14 polymorphism with myocardial infarction in a Japanese population.
14568956 2003 Complement regulatory protein C1 inhibitor binds to selectins and interferes with endothelial-leukocyte adhesion.
14557872 2003 Evidence for substantial effect modification by gender in a large-scale genetic association study of the metabolic syndrome among coronary heart disease patients.
14534081 2004 Stimulation of adhesion molecule expression in human endothelial cells (HUVEC) by adrenomedullin and corticotrophin.
12960351 2003 Lipid raft localization of cell surface E-selectin is required for ligation-induced activation of phospholipase C gamma.
12940514 2003 Circulating transforming growth factor-beta1, lipoprotein(a) and cellular adhesion molecules in angiographically assessed coronary artery disease.
12898464 2003 Relationship between circulating E-selectin, DD genotype of angiotensin-converting-enzyme, and cardiovascular damage in central obese subjects.
12871600 2003 Genetic risk factors for cerebrovascular disease in children with sickle cell disease: design of a case-control association study and genomewide screen.
12820726 Tumor cell MUC1 and CD43 are glycosylated differently with sialyl-Lewis a and x epitopes and show variable interactions with E-selectin under physiological flow conditions.
12792758 High serum soluble E-selectin levels are associated with postoperative haematogenic recurrence in esophageal squamous cell carcinoma patients.
12788528 2003 Different mechanisms of adhesion molecule expression in human dermal microvascular endothelial cells by xanthoma tissue-mediated and copper-mediated oxidized low density lipoproteins.
12768436 2003 Characterization of 458 single nucleotide polymorphisms of disease candidate genes in the Korean population.
12738381 2003 Interactions of the gastrotropic bacterium Helicobacter pylori with the leukocyte-endothelium adhesion molecules, the selectins--a preliminary report.
12698264 2003 Enhanced expression of E-selectin on the vascular endothelium of peripheral nerve in critically ill patients with neuromuscular disorders.
12673844 Activation of vascular endothelial cell adhesion molecule expression by sickle blood cells.
12649084 2003 E-selectin polymorphism associated with myocardial infarction causes enhanced leukocyte-endothelial interactions under flow conditions.
12626663 2003 AGI-1067: a multifunctional phenolic antioxidant, lipid modulator, anti-inflammatory and antiatherosclerotic agent.
12595908 2003 Variation in immune response genes and chronic Q fever. Concepts: preliminary test with post-Q fever fatigue syndrome.
12522014 2003 Src and phosphatidylinositol 3-kinase mediate soluble E-selectin-induced angiogenesis.
12499405 2002 An investigation of the interactions of E-selectin with fuco-oligosaccharides of the blood group family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421968 2002 Enhanced recruitment of Th2 and CLA-negative lymphocytes by the S128R polymorphism of E-selectin.
12388172 2003 E-selectin-inducing activity in plasma from type 2 diabetic patients with maculopathy.
12200386 2002 Hydrocortisone reduced in vivo, inflammation-induced slow rolling of leukocytes and their extravasation into human conjunctiva.
12200076 Leukocyte-endothelial cell adhesion molecule 1 (LECAM-1) polymorphism is associated with diabetic nephropathy in type 2 diabetes mellitus.
12186696 2002 L and E selectins in acute myeloid leukemia: expression, clinical relevance and relation to patient outcome.
12175121 Lack of association between A561C E-selectin polymorphism and large and small-sized blood vessel vasculitides.
12172576 2002 Down regulation of endothelial adhesion molecules in node positive breast cancer: possible failure of host defence mechanism.
12172318 2002 Soluble cell adhesion molecules in hypertensive concentric left ventricular hypertrophy.
12165498 2002 L-selectin serves as an E-selectin ligand on cultured human T lymphoblasts.
12086338 2002 Expression of ICAM-1, VCAM-1, E-selectin and TNF-alpha on the endothelium of femoral and iliac arteries in thromboangiitis obliterans.
12082592 2002 Multi-locus interactions predict risk for post-PTCA restenosis: an approach to the genetic analysis of common complex disease.
12082590 2002 The contribution of genetic factors to thrombotic and bleeding outcomes in coronary patients randomised to IIb/IIIa antagonists.
12036529 2002 The E-selectin SER128ARG gene polymorphism and restenosis after successful coronary angioplasty.
12027924 2002 Intercellular adhesion molecule-1 (ICAM-1) polymorphism is associated with diabetic retinopathy in Type 2 diabetes mellitus.
12020443 2002 Mononuclear cell adhesion and cell adhesion molecule liberation after X-irradiation of activated endothelial cells in vitro.
12011765 2002 Blood serum levels of soluble forms of adhesion molecules ICAM-1 (sICAM-1) and selectin E (s-selectin E) in patients with various phases of non-Hodgkin's lymphomas.
11983205 2002 Quantification of the influence of mycophenolic acid on the release of endothelial adhesion molecules.
11981814 2002 Contribution of selectin ligands to eosinophil recruitment into the skin of patients with atopic dermatitis.
11936588 Soluble selectin levels in patients with lung cancer.
11935152 2002 Relation between glycaemic control, hyperinsulinaemia and plasma concentrations of soluble adhesion molecules in patients with impaired glucose tolerance or Type II diabetes.
11929779 2002 Human mast cell progenitors use alpha4-integrin, VCAM-1, and PSGL-1 E-selectin for adhesive interactions with human vascular endothelium under flow conditions.
11882338 2002 Serum levels of adhesion molecules correlate with insulin resistance.
11859093 2002 Cutting Edge: Internalization of transduced E-selectin by cultured human endothelial cells: comparison of dermal microvascular and umbilical vein cells and identification of a phosphoserine-type di-leucine motif.
11847011 2002 Circulating endothelial adhesion molecules (sE-selectin, sVCAM-1 and sICAM-1) during rHuG-CSF-stimulated stem cell mobilization.
11828340 2002 Association between single-nucleotide polymorphisms in selectin genes and immunoglobulin A nephropathy.
11827962 2002 The human immunodeficiency virus-1 Tat protein activates human umbilical vein endothelial cell E-selectin expression via an NF-kappa B-dependent mechanism.
11776680 2001 Localization and quantification of adhesion molecule expression in the lower uterine segment during premature labor.
11714857 2001 Genetic influences on lipid metabolism trait variability within the Stanislas Cohort.
11697721 2001 Day-night variations in blood levels of nitric oxide, T-TFPI, and E-selectin.
11602579 2001 Molecular events in transmembrane signaling via E-selectin. SHP2 association, adaptor protein complex formation and ERK1/2 activation.
11575218 2001 [Association between E-selectin Leu554Phe polymorphism and blood pressure in the Stanislas cohort].
11575217 2001 [APOC3, CETP, beta-fibrinogen and MTHFR are genetic determinants of carotid intim-media thickness (Stanislas cohort)].
11466561 2001 Gender- and age-dependent relationships between the E-selectin S128R polymorphism and coronary artery calcification.
11404363 2001 Affinity, kinetics, and thermodynamics of E-selectin binding to E-selectin ligand-1.
11402070 2001 CD44 is a major E-selectin ligand on human hematopoietic progenitor cells.
11359462 2001 APOC3, CETP, fibrinogen, and MTHFR are genetic determinants of carotid intima-media thickness in healthy men (the Stanislas cohort).
11341749 2001 Candidate gene polymorphisms in cardiovascular disease: a comparative study of frequencies between a French and an Italian population.
11168027 2001 An HphI polymorphism in the E-selectin gene is associated with premature coronary artery disease.
11097335 2000 Familial studies on the genetics of cardiovascular diseases: the Stanislas cohort.
11081633 2000 Insights into the molecular basis of leukocyte tethering and rolling revealed by structures of P- and E-selectin bound to SLe(X) and PSGL-1.
10982036 2000 Relationship between E-selectin L/F554 polymorphism and blood pressure in the Stanislas cohort.
10477700 1999 Human immunodeficiency virus-1 (HIV-1)-Tat protein promotes migration of acquired immunodeficiency syndrome-related lymphoma cells and enhances their adhesion to endothelial cells.
10419878 1999 Loss of endothelial surface expression of E-selectin in a patient with recurrent infections.
10391210 1999 Patterns of single-nucleotide polymorphisms in candidate genes for blood-pressure homeostasis.
9933738 1999 A PstI polymorphism detects the mutation of serine128 to arginine in CD 62E gene - a risk factor for coronary artery disease.
9920928 1999 E-selectin gene expression is induced synergistically with the coexistence of activated classic protein kinase C and signals elicited by interleukin-1beta but not tumor necrosis factor-alpha.
9597096 1997 HIV-protein-mediated alterations in T cell interactions with the extracellular matrix proteins and endothelium.
9312078 1997 Cytoplasmic domain of E-selectin contains a non-tyrosine endocytosis signal.
9290466 1997 Circulating endothelial cell adhesion molecules as diagnostic markers for the early identification of pregnant women at risk for development of preeclampsia.
9269771 1997 Human immunodeficiency virus-1-tat protein induces the cell surface expression of endothelial leukocyte adhesion molecule-1, vascular cell adhesion molecule-1, and intercellular adhesion molecule-1 in human endothelial cells.
9128259 1997 Isolated P-selectin glycoprotein ligand-1 dynamic adhesion to P- and E-selectin.
9024699 1997 L-selectin from human, but not from mouse neutrophils binds directly to E-selectin.
8621728 1996 Post-translational modifications of recombinant P-selectin glycoprotein ligand-1 required for binding to P- and E-selectin.
8609175 1996 Leukocyte adhesion to vascular endothelium induces E-selectin linkage to the actin cytoskeleton.
8557254 1996 DNA polymorphisms in adhesion molecule genes--a new risk factor for early atherosclerosis.
7694691 1993 Divergent fates of P- and E-selectins after their expression on the plasma membrane.
7693046 1993 Exogenous tat protein activates human endothelial cells.
7681016 1993 Modelling the carbohydrate recognition domain of human E-selectin.
7680663 1993 Higher-affinity oligosaccharide ligands for E-selectin.
7541576 1995 Circulating adhesion molecules during kidney allograft rejection.
7538217 1995 Effects of modified low density lipoprotein and hypoxia on the expression of endothelial leukocyte adhesion molecule-1.
7536194 1995 Modulation of E-selectin structure/function by metal ions. Studies on limited proteolysis and metal ion regeneration.
7533025 1994 E-selectin polymorphism and atherosclerosis: an association study.
7523444 1994 Exogenous tat protein activates central nervous system-derived endothelial cells.
7509040 1994 Insight into E-selectin/ligand interaction from the crystal structure and mutagenesis of the lec/EGF domains.
2466335 1989 Endothelial leukocyte adhesion molecule 1: an inducible receptor for neutrophils related to complement regulatory proteins and lectins.
1703529 1991 Structure and chromosomal location of the gene for endothelial-leukocyte adhesion molecule 1.
1701274 1990 ELAM-1 mediates cell adhesion by recognition of a carbohydrate ligand, sialyl-Lex.
1694218 1990 Genomic organization of the selectin family of leukocyte adhesion molecules on human and mouse chromosome 1.
1689848 1990 Endothelial leukocyte adhesion molecule 1: direct expression cloning and functional interactions.
1375831 1992 Cell-cell contact mechanisms.