Property Summary

NCBI Gene PubMed Count 24
PubMed Score 0.00
PubTator Score 9.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
gastric cancer 1.100 2.9e-04
pancreatic cancer 1.100 5.3e-04
malignant mesothelioma -1.700 5.9e-07
psoriasis -1.800 6.8e-05
osteosarcoma -1.281 7.6e-05
cystic fibrosis 1.150 9.5e-04
medulloblastoma, large-cell -1.700 1.0e-04
primitive neuroectodermal tumor -1.100 5.4e-05
tuberculosis and treatment for 6 months -1.700 6.1e-06
intraductal papillary-mucinous adenoma (... 1.100 1.8e-03
intraductal papillary-mucinous carcinoma... 1.100 4.3e-03
active Crohn's disease 1.190 5.3e-03
pancreatic carcinoma 1.100 5.3e-04
spina bifida -2.100 3.6e-02
ovarian cancer -1.600 4.2e-07

Gene RIF (3)

PMID Text
26082458 the target gene SEC22B regulated by miRNA-206 may play a key role in the progression and development of AD.
24705552 Suggest that close apposition of the ER and plasma membrane mediated by Sec22b and plasma membrane syntaxins generates a non-fusogenic SNARE bridge contributing to plasma membrane expansion, probably through non-vesicular lipid transfer.
22264512 DrrA activation of the Rab1 GTPase on plasma membrane-derived organelles stimulated the tethering of endoplasmic reticulum-derived vesicles, resulting in vesicle fusion through the pairing of Sec22b with the plasma membrane syntaxin proteins.

AA Sequence

MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVC      1 - 70
DLVLCEAAFPKTLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSCARRNLGSINT     71 - 140
ELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNMHSTYAKLAAVAVFFIMLIVYV    141 - 210
RFWWL                                                                     211 - 215
//

Text Mined References (35)

PMID Year Title
26082458 2016 Identification of Biomarkers Associated With Alzheimer's Disease by Bioinformatics Analysis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24705552 2014 The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22264512 2012 The Legionella pneumophila effector DrrA is sufficient to stimulate SNARE-dependent membrane fusion.
22153078 2011 Sec22b regulates phagosomal maturation and antigen crosspresentation by dendritic cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21242315 2011 Autophagic substrate clearance requires activity of the syntaxin-5 SNARE complex.
20210993 2010 Identification and analysis of unitary pseudogenes: historic and contemporary gene losses in humans and other primates.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19369418 2009 Identification of the neuroblastoma-amplified gene product as a component of the syntaxin 18 complex implicated in Golgi-to-endoplasmic reticulum retrograde transport.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16354670 2006 Involvement of a novel Q-SNARE, D12, in quality control of the endomembrane system.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15308636 2004 Proteomics of endoplasmic reticulum-Golgi intermediate compartment (ERGIC) membranes from brefeldin A-treated HepG2 cells identifies ERGIC-32, a new cycling protein that interacts with human Erv46.
15272311 2004 Involvement of BNIP1 in apoptosis and endoplasmic reticulum membrane fusion.
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
11035026 2000 Subunit structure of a mammalian ER/Golgi SNARE complex.
11001058 2000 Topological restriction of SNARE-dependent membrane fusion.
9950687 1999 Morphological and functional association of Sec22b/ERS-24 with the pre-Golgi intermediate compartment.
9653160 1998 Identification of genes expressed in human CD34(+) hematopoietic stem/progenitor cells by expressed sequence tags and efficient full-length cDNA cloning.
9166403 1997 ERS-24, a mammalian v-SNARE implicated in vesicle traffic between the ER and the Golgi.
9094723 1997 Protein interactions regulating vesicle transport between the endoplasmic reticulum and Golgi apparatus in mammalian cells.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.