Property Summary

NCBI Gene PubMed Count 25
PubMed Score 0.00
PubTator Score 9.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease 1.190 5.3e-03
cystic fibrosis 1.150 9.5e-04
gastric cancer 1.100 2.9e-04
intraductal papillary-mucinous adenoma (... 1.100 1.8e-03
intraductal papillary-mucinous carcinoma... 1.100 4.3e-03
malignant mesothelioma -1.700 5.9e-07
medulloblastoma, large-cell -1.700 1.0e-04
osteosarcoma -1.237 1.7e-03
ovarian cancer -1.600 4.2e-07
pancreatic cancer 1.100 5.3e-04
pancreatic carcinoma 1.100 5.3e-04
primitive neuroectodermal tumor -1.100 5.4e-05
psoriasis -1.800 6.8e-05
spina bifida -2.100 3.6e-02
tuberculosis -1.100 2.3e-04

Gene RIF (4)

AA Sequence

MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVC      1 - 70
DLVLCEAAFPKTLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSCARRNLGSINT     71 - 140
ELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNMHSTYAKLAAVAVFFIMLIVYV    141 - 210
RFWWL                                                                     211 - 215
//

Text Mined References (37)

PMID Year Title