Property Summary

NCBI Gene PubMed Count 12
PubMed Score 23.15
PubTator Score 14.99

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma 1.400 5.4e-04
atypical teratoid/rhabdoid tumor 1.100 1.1e-04
Breast cancer 2.500 2.8e-02
ependymoma 1.100 1.6e-05
glioblastoma 1.300 9.2e-07
group 4 medulloblastoma 1.500 3.1e-04
lung cancer 1.700 3.4e-02
medulloblastoma, large-cell 1.200 4.1e-03

Gene RIF (6)

AA Sequence

MPGRHVSRVRALYKRVLQLHRVLPPDLKSLGDQYVKDEFRRHKTVGSDEAQRFLQEWEVYATALLQQANE      1 - 70
NRQNSTGKACFGTFLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSISESMKPKF                    71 - 125
//

Text Mined References (13)

PMID Year Title