Property Summary

NCBI Gene PubMed Count 112
PubMed Score 255.62
PubTator Score 183.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Gene RIF (95)

PMID Text
26350464 demonstrate that HER2 is captured via a site, comprised of amino acids 210-240, in the extracellular domain of human Sdc1, and EGFR is captured via an extracellular site comprised of amino acids 87-131 in human Sdc4
26261514 Synd4 shedding is a molecular pathological alteration in the development and maintenance of inflammation-associated atrial fibrillation.
26254886 results suggest that SDC4 alleles affect lipid profile in elderly subjects and may in part mediate the link between LDL-C and longevity.
26160374 Syndecan-4 is essential for transmitting the mechanotransduction signals via activation of PKC-alpha and is important for tumor cells spreading, assembly of actin cytoskeleton and cell contractility.
25449226 define a role for TG2 activity at the surface of human macrophages in multiple stages of AC clearance and we propose that TG2, in association with heparan sulphates may exert its effect on AC clearance via a mechanism involving the crosslinking of CD44
25410619 Syndecan-4 polymorphisms were associated with essential hypertension, body mass index, and coronary artery disease prevalence in the Tampere adult population cardiovascular risk study.
25404299 Data indicate that depletion of syndecan 4 (S4) in umbilical vein endothelial cells (HUVECs) using shRNA inhibited flow-induced alignment in vitro, which was rescued by re-expression of S4.
25361632 No association was found with SDC4 and breast cancer.
25216363 Dynamic catch of a Thy-1-integrin alpha5beta1+syndecan-4 trimolecular complex explains extraordinary cancer cell adhesion to the vascular endothelium.
25202019 Sdc4 is necessary for activation of the integrin during chemokinesis induced by EGF.
25122554 syndecan 4 is the predominant heparan sulfate proteoglycan in the glomerular endothelial cells glycocalyx
24956062 Data indicate that the extracellular and cytoplasmic domains of syndecans 1/2/3/4 are intrinsically disordered regions.
24942878 High glucose modifies TRPC6 channels and ROS production via SDC-4 in human podocytes.
24632200 The cytoplasmic V domain of syndecan-4 made a significant contribution to the cellular uptake of octaarginine, whereas the cytoplasmic C1 and C2 domains were not involved in the process.
24558194 in healthy discs, SDC4, through its heparan sulfate side chains, contributes to maintenance of the hypoxic tissue niche by controlling baseline expression of Sox9.
23948417 The more upgraded the NYHA grading, the higher level of serum syndecan-4 protein.
23844358 syndecan-4 is differentially expressed in seminomas and nonseminomatous germ cell tumours and might be a useful marker.
23576453 NF-kappaB p65 could be a key mediator of syndecan-4 upregulation by TNF-alpha through two binding sites in the SDC4 promoter, but other NF-kappaB-p65 independent pathways might also be involved through transcriptional elongation.
23525101 PGE2-induced activation of angiogenesis is mediated via syndecan-4-dependent activation of PKCalpha.
23499501 TGM2 up-regulation along with ITGB1 and SDC4 plays an important role in the development of RCC tumors and advanced RCC with metastasis
23374155 EGFR are the key mediators of SDC-4 expression in MCF-7 cells.
23374111 Syndecan-4 expression and shedding were increased in failing human myocardium.
22721673 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
22569333 studies identify S4 as a regulator of MAPK signaling and address the question of how distinct classes of FGFRs individually contribute to signal transduction in endothelial cells
22531343 Increased expression of SDC4 and FN may be underlying molecular alteration of osteo-sarcoma which accounts for more aggressive clinical behaviour.
22351752 the LAMA3 LG45 domain may trigger different signals toward keratinocytes depending on its interaction with syndecan-1 or -4.
22268118 By accruing more syndecan-4 on their surface and also shedding it during Th1 cytokine-driven inflammation, asthmatic airway smooth muscle cells may regulate inflammation and remodeling locally and alter the responsiveness of the airways in asthma.
22164265 Syndecan-4 is essential for development of concentric myocardial hypertrophy via stretch-induced activation of the calcineurin-NFAT pathway
21949132 in nucleus pulposus, TNF-alpha and IL-1beta regulate SDC4 expression, which plays a key role in pathogenesis of degenerative disc disease by promoting aggrecan degradation by ADAMTS-5.
21482826 HIV-1 p17 matrix protein interacts with heparan sulfate side chain of CD44v3, syndecan-2, and syndecan-4 proteoglycans expressed on human activated CD4+ T cells affecting tumor necrosis factor alpha and interleukin 2 production.
21482826 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
21430259 There was a statistical relationship between syndecan-1 presence in high-grade tumors and absence of syndecan-4, whereas syndecan-4 presence in cases positive for estrogen and progesterone receptor associated with syndecan-1 absence
21414405 Syndecan-1 and -4 differentially regulate oncogenic K-ras dependent cell invasion
21252093 SD-4 bearing distinct heparan sulfate moieties plays a pathogenic role in Sezary syndrome and may be targeted for treatment.
21114861 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
21036168 syndecan-2 and syndecan-4 regulate the compensatory effect of TG-FN on osteoblast cell adhesion and actin cytoskeletal formation in the presence of RGD peptides.
20929862 RGD-independent cell adhesion via a tissue transglutaminase 2-fibronectin matrix promotes fibronectin fibril deposition and requires syndecan-4/2 and {alpha}5{beta}1 integrin co-signaling.
20639201 Data found that Wnt5a reduces cell surface levels and promotes ubiquitination and degradation of SDC4.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20607801 In dendritic cells, lysophosphatidylcholine-induced phosphorylation of SDC4 by PKCdelta results in a functional inactivation of SDC4 and decreases adhesion and motility.
20485444 Observational study of gene-disease association. (HuGE Navigator)
20398359 Expression of syndecan 4 in healthy human breast tissue during menstrual cycle.
20229236 SDC4 promotes cytokinesis in a phosphorylation-dependent manner in MCF-7 breast adenocarcinoma cells. The serine179-phosphorylation and the ectodomain shedding of SDC4 changed periodically in a cell cycle-dependent way.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19875451 ADAM17 may therefore be an important regulator of syndecan functions on inflamed lung epithelium.
19822079 Data report that the bFGF, FGFR1/2 and syndecan 1-4 expressions are altered in bladder tumours.
19821490 Study identified an overrepresentation of focal amplifications of known (FGFR3, CCND1, MYC, MDM2) and novel candidate genes (MYBL2, YWHAB and SDC4) in stage Ta bladder carcinoma.
19696445 syndecan 1 and 4 correlate to increased metastatic potential in melanoma patients and are an important component of the Wnt5A autocrine signaling loop
19695308 The down-regulation of syndecan-4, a heparan sulfate proteoglycan, decreased SDF-1/CXCL12-mediated HeLa cell invasion.
19684582 syndecan-4 is specifically induced in type X collagen-producing chondrocytes in osteoarthritis
19632304 Study indicates that SDC-1 and -4 may be required for HepG2, Hep3B and Huh7 human hepatoma cell migration, invasion or spreading induced by the chemokine.
19538537 Syndecan-4 may be a sensor of tension exerted on the matrix [review]
19519784 The present study shows that highly pathogenic H. pylori strains induce syndecan-4 expression, both in human gastric mucosa and in gastric cell lines, in a cag pathogenicity island-dependent manner.
19350579 SD-4 is the T-cell ligand of DC-HIL.
18775505 ADAMTS1, involved in angiogenesis and inflammatory processes, cleaves the ectodomain of syndecan-4. This cleavage results in altered distribution of cytoskeleton components, functional loss of adhesion, and gain of migratory capacities.
18638267 None of the SDC4 polymorphisms showed a difference in their allelic distribution between leg ulcer patients and controls. SDC4 may play a role in wound healing, but expression abnormalities in uninvolved dermis may contribute to venous ulcer development.
18638267 Observational study of gene-disease association. (HuGE Navigator)
18499669 TG-FN binding to syndecan-4 activates PKCalpha leading to its association with beta(1) integrin, reinforcement of actin-stress fiber organization, and MAPK pathway activation
18342939 This study provides evidence for the up-regulation of syndecan-2 and -4 in human primary CD4 T cells during in vitro activation and suggest an inhibitory role for these syndecans in CD4 T cells.
18158320 syndecan-4 is a critical intrinsic regulator of inflammatory reactions via its effects on OPN function
18093920 syndecan TMD homodimerization and heterodimerization can be mediated by GxxxG motifs and modulated by sequence context
17901052 analysis of how a peptide derived from tenascin-C induces beta1 integrin activation through syndecan-4
17879962 These results identify syndecan-4 as a novel receptor for the N-terminus of TSP-1 and suggest that TSP-1 N-terminal pro-angiogenic activity is linked to its capacity of interfering with syndecan-4 functions in the course of cell adhesion.
17870067 An alternate pathway mediated by the extracellular domains of syndecans-2 and -4 is characterized that is independent of both heparan sulphate and syndecan signaling.
17545042 The expression of syndecan-4 protein was significantly enhanced by TNF-alpha in HUVECs.
16934308 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
16822948 Stress-induced effects on smooth muscle cell syndecan-4 expression and shedding may represent an additional component of proinflammatory, growth-stimulating pathways activated in response to changes in the mechanical microenvironment of the vascular wall.
16817962 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
16636895 Syndecan-1 and syndecan-4 may have roles in progression of breast carcinoma
16319082 The H. pylori- and TLR-induced increase in syndecan-4 mRNA was blocked by the proteosome inhibitor MG-132 suggesting a role for nuclear factor kappaB (NF-kappaB) in the regulation of syndecan-4 gene expression
16253987 the transmembrane domains are sufficient for inducing dimerization and transmembrane domain-induced oligomerization is crucial for syndecan-2 and syndecan-4 functions
16157597 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
16087677 Plasmin and thrombin accelerate shedding of syndecan-4 ectodomain, which generates cleavage sites at Lys(114)-Arg(115) and Lys(129)-Val(130) bonds
15968398 may play important roles in the regulation of inflammatory effects of platelets
15819887 CXCL12 directly binds to syndecan-4 in a glycosaminoglycan-dependent manner
15797855 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
15731100 Syndecan-4 has a critical role in thrombin-induced migration and proliferation in human vascular smooth muscle cells
15572366 human trabecular meshwork cells express only syndecan-1, and not syndecan-4, at the cell surface, and focal adhesion and stress fiber formation occur independent of syndecan-4
15033938 syndecan-4/CXCR4 complex is likely a functional unit involved in SDF-1 binding
14652650 endotoxin-induced adhesion of leukocytes to endothelium can be reversed by ligation of syndecan-4 with antithrombin's heparin-binding site
12885232 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
12509413 Syndecan-4 can promote cell spreading in a beta(1) integrin-dependent fashion through PKCalpha and RhoA
12493766 the focal adhesion component alpha-actinin interacts with syndecan-4 in a beta-integrin-independent manner
12377772 SDC4 regulates inositol phospholipid binding and signaling
12011116 Syndecan-4 core protein mediates the effects of fibroblast growth factor (FGF)2 on cell function. PKCalpha activation and PDZ-mediated formation of a serine/threonine phosphatase-containing complex by syndecan-4 are downstream events of FGF2 signaling.
11889131 Clustering induces redistribution of syndecan-4 core protein into raft membrane domains
11801740 Syndecan-4 mediates antithrombin-induced chemotaxis of human peripheral blood lymphocytes and monocytes
11567105 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
11549250 Studies suggest that antithrombin regulates neutrophil migration via effects of its heparin-binding site on cell surface syndecan-4.
11024024 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
10497173 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
9342064 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
9111037 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
8570206 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
7690138 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans

AA Sequence

MAPARLFALLLFFVGGVAESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLE      1 - 70
DSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNI     71 - 140
FERTEVLAALIVGGIVGILFAVFLILLLMYRMKKKDEGSYDLGKKPIYKKAPTNEFYA                141 - 198
//

Text Mined References (120)

PMID Year Title
26350464 2015 Syndecan-1 and Syndecan-4 Capture Epidermal Growth Factor Receptor Family Members and the ?3?1 Integrin Via Binding Sites in Their Ectodomains: NOVEL SYNSTATINS PREVENT KINASE CAPTURE AND INHIBIT ?6?4-INTEGRIN-DEPENDENT EPITHELIAL CELL MOTILITY.
26261514 2015 Syndecan-4 shedding is involved in the oxidative stress and inflammatory responses in left atrial tissue with valvular atrial fibrillation.
26254886 2015 Metabolism and successful aging: Polymorphic variation of syndecan-4 (SDC4) gene associate with longevity and lipid profile in healthy elderly Italian subjects.
26160374 2015 Syndecan-4 Promotes Epithelial Tumor Cells Spreading and Regulates the Turnover of PKC? Activity under Mechanical Stimulation on the Elastomeric Substrates.
25449226 2015 Transglutaminase 2 interacts with syndecan-4 and CD44 at the surface of human macrophages to promote removal of apoptotic cells.
25416956 2014 A proteome-scale map of the human interactome network.
25410619 2014 Contribution of syndecan-4 genetic variants to hypertension, the TAMRISK study.
25404299 2014 Syndecan 4 is required for endothelial alignment in flow and atheroprotective signaling.
25361632 2015 Association of heparan sulfate proteoglycans SDC1 and SDC4 polymorphisms with breast cancer in an Australian Caucasian population.
25216363 2014 Dynamic catch of a Thy-1-?5?1+syndecan-4 trimolecular complex.
25202019 2014 Cytoplasmic domain interactions of syndecan-1 and syndecan-4 with ?6?4 integrin mediate human epidermal growth factor receptor (HER1 and HER2)-dependent motility and survival.
25122554 2014 Matrix metalloproteinase 9-mediated shedding of syndecan 4 in response to tumor necrosis factor ?: a contributor to endothelial cell glycocalyx dysfunction.
24956062 2015 Cell communication using intrinsically disordered proteins: what can syndecans say?
24942878 2014 High glucose modifies transient receptor potential canonical type 6 channels via increased oxidative stress and syndecan-4 in human podocytes.
24632200 2014 Molecular interplays involved in the cellular uptake of octaarginine on cell surfaces and the importance of syndecan-4 cytoplasmic V domain for the activation of protein kinase C?.
24558194 2014 HIF-1-PHD2 axis controls expression of syndecan 4 in nucleus pulposus cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23948417 2013 [Changes and clinical significance of serum level of syndecan-4 protein in patients with chronic congestive heart failure].
23844358 2013 Expression of syndecan-4 and correlation with metastatic potential in testicular germ cell tumours.
23576453 2013 Molecular mechanisms of syndecan-4 upregulation by TNF-? in the endothelium-like EAhy926 cells.
23525101 2013 The syndecan-4/protein kinase C? pathway mediates prostaglandin E2-induced extracellular regulated kinase (ERK) activation in endothelial cells and angiogenesis in vivo.
23499501 2014 Up-regulation of TGM2 with ITGB1 and SDC4 is important in the development and metastasis of renal cell carcinoma.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23374155 2013 Evaluation of the coordinated actions of estrogen receptors with epidermal growth factor receptor and insulin-like growth factor receptor in the expression of cell surface heparan sulfate proteoglycans and cell motility in breast cancer cells.
23374111 2013 Innate immune signaling induces expression and shedding of the heparan sulfate proteoglycan syndecan-4 in cardiac fibroblasts and myocytes, affecting inflammation in the pressure-overloaded heart.
22660413 2012 Syndecan-syntenin-ALIX regulates the biogenesis of exosomes.
22569333 2012 Syndecan 4 regulates FGFR1 signaling in endothelial cells by directing macropinocytosis.
22531343 2012 Syndecan-4 and fibronectin in osteosarcoma.
22351752 2012 Cell surface proteoglycans syndecan-1 and -4 bind overlapping but distinct sites in laminin ?3 LG45 protein domain.
22268118 2012 Th1 cytokine-induced syndecan-4 shedding by airway smooth muscle cells is dependent on mitogen-activated protein kinases.
22164265 2011 Syndecan-4 is essential for development of concentric myocardial hypertrophy via stretch-induced activation of the calcineurin-NFAT pathway.
21949132 2011 TNF-? and IL-1? promote a disintegrin-like and metalloprotease with thrombospondin type I motif-5-mediated aggrecan degradation through syndecan-4 in intervertebral disc.
21482826 2011 HIV-1 p17 matrix protein interacts with heparan sulfate side chain of CD44v3, syndecan-2, and syndecan-4 proteoglycans expressed on human activated CD4+ T cells affecting tumor necrosis factor alpha and interleukin 2 production.
21430259 2011 Syndecan-1 and syndecan-4 are independent indicators in breast carcinoma.
21414405 2011 Syndecan-1 and -4 differentially regulate oncogenic K-ras dependent cell invasion into collagen through ?2?1 integrin and MT1-MMP.
21269460 2011 Initial characterization of the human central proteome.
21252093 2011 Sézary syndrome cells overexpress syndecan-4 bearing distinct heparan sulfate moieties that suppress T-cell activation by binding DC-HIL and trapping TGF-beta on the cell surface.
21036168 2011 Importance of syndecan-4 and syndecan -2 in osteoblast cell adhesion and survival mediated by a tissue transglutaminase-fibronectin complex.
20953189 2010 Genome-wide association analysis identifies three psoriasis susceptibility loci.
20929862 2010 RGD-independent cell adhesion via a tissue transglutaminase-fibronectin matrix promotes fibronectin fibril deposition and requires syndecan-4/2 ?5?1 integrin co-signaling.
20639201 2010 Non-canonical Wnt signaling induces ubiquitination and degradation of Syndecan4.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20607801 2010 Lysophosphatidylcholine-mediated functional inactivation of syndecan-4 results in decreased adhesion and motility of dendritic cells.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20398359 2010 The expression of syndecan-1, syndecan-4 and decorin in healthy human breast tissue during the menstrual cycle.
20229236 2010 Syndecan-4 promotes cytokinesis in a phosphorylation-dependent manner.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19875451 2010 A disintegrin and metalloproteinase 17 (ADAM17) mediates inflammation-induced shedding of syndecan-1 and -4 by lung epithelial cells.
19822079 Expression of basic fibroblast growth factor, its receptors and syndecans in bladder cancer.
19821490 2010 Focal amplifications are associated with high grade and recurrences in stage Ta bladder carcinoma.
19696445 2009 Heparan sulfate proteoglycan modulation of Wnt5A signal transduction in metastatic melanoma cells.
19695308 2009 Glycosaminoglycans and syndecan-4 are involved in SDF-1/CXCL12-mediated invasion of human epitheloid carcinoma HeLa cells.
19684582 2009 Syndecan-4 regulates ADAMTS-5 activation and cartilage breakdown in osteoarthritis.
19632304 2009 Syndecan-1 and syndecan-4 are involved in RANTES/CCL5-induced migration and invasion of human hepatoma cells.
19538537 2009 Syndecan proteoglycan contributions to cytoskeletal organization and contractility.
19519784 2009 Helicobacter pylori cag pathogenicity island-positive strains induce syndecan-4 expression in gastric epithelial cells.
19350579 2009 The DC-HIL/syndecan-4 pathway inhibits human allogeneic T-cell responses.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18775505 2009 Cleavage of syndecan-4 by ADAMTS1 provokes defects in adhesion.
18638267 The altered expression of syndecan 4 in the uninvolved skin of venous leg ulcer patients may predispose to venous leg ulcer.
18499669 2008 Fibronectin-tissue transglutaminase matrix rescues RGD-impaired cell adhesion through syndecan-4 and beta1 integrin co-signaling.
18342939 2008 Syndecan-2 and -4 expressed on activated primary human CD4+ lymphocytes can regulate T cell activation.
18158320 2008 Syndecan-4 protects against osteopontin-mediated acute hepatic injury by masking functional domains of osteopontin.
18093920 2007 Transmembrane domains of the syndecan family of growth factor coreceptors display a hierarchy of homotypic and heterotypic interactions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17901052 2007 A peptide derived from tenascin-C induces beta1 integrin activation through syndecan-4.
17879962 2008 Syndecan-4 contributes to endothelial tubulogenesis through interactions with two motifs inside the pro-angiogenic N-terminal domain of thrombospondin-1.
17870067 2007 Syndecans promote integrin-mediated adhesion of mesenchymal cells in two distinct pathways.
17545042 2007 [Tumor necrosis factor-alpha regulates the proliferation and syndecan-4 expression of human umbilical vein endothelial-like cells cultured in vitro].
16822948 2007 Mechanical strain regulates syndecan-4 expression and shedding in smooth muscle cells through differential activation of MAP kinase signaling pathways.
16636895 2006 Syndecan-1 and syndecan-4 are overexpressed in an estrogen receptor-negative, highly proliferative breast carcinoma subtype.
16533050 2006 The binding of the PDZ tandem of syntenin to target proteins.
16319082 2006 Helicobacter pylori and toll-like receptor agonists induce syndecan-4 expression in an NF-kappaB-dependent manner.
16253987 2005 Transmembrane domain-induced oligomerization is crucial for the functions of syndecan-2 and syndecan-4.
16087677 2005 Plasmin- and thrombin-accelerated shedding of syndecan-4 ectodomain generates cleavage sites at Lys(114)-Arg(115) and Lys(129)-Val(130) bonds.
16007225 2005 Adhesion signaling by a novel mitotic substrate of src kinases.
15968398 2005 Expression and function of syndecan-4 in human platelets.
15819887 2005 Syndecan-4 is a signaling molecule for stromal cell-derived factor-1 (SDF-1)/ CXCL12.
15731100 2005 Syndecan-4 is required for thrombin-induced migration and proliferation in human vascular smooth muscle cells.
15572366 2005 Heparin II domain of fibronectin uses alpha4beta1 integrin to control focal adhesion and stress fiber formation, independent of syndecan-4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15033938 2004 A syndecan-4/CXCR4 complex expressed on human primary lymphocytes and macrophages and HeLa cell line binds the CXC chemokine stromal cell-derived factor-1 (SDF-1).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14675776 2003 Widespread production of novel soluble protein isoforms by alternative splicing removal of transmembrane anchoring domains.
14652650 2003 Syndecan-4-dependent signaling in the inhibition of endotoxin-induced endothelial adherence of neutrophils by antithrombin.
14637022 2003 Interaction of RANTES with syndecan-1 and syndecan-4 expressed by human primary macrophages.
12885232 2003 Structural and dynamic properties of the HIV-1 tat transduction domain in the free and heparin-bound states.
12842047 2003 Molecular roots of degenerate specificity in syntenin's PDZ2 domain: reassessment of the PDZ recognition paradigm.
12571249 2003 Direct binding of syndecan-4 cytoplasmic domain to the catalytic domain of protein kinase C alpha (PKC alpha) increases focal adhesion localization of PKC alpha.
12509413 2003 ADAM12/syndecan-4 signaling promotes beta 1 integrin-dependent cell spreading through protein kinase Calpha and RhoA.
12493766 2003 Syndecan-4 associates with alpha-actinin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12377772 2002 Regulation of inositol phospholipid binding and signaling through syndecan-4.
12241528 2002 Cytoplasmic interactions of syndecan-4 orchestrate adhesion receptor and growth factor receptor signalling.
11916978 2002 Protein kinase C (PKC) delta regulates PKCalpha activity in a Syndecan-4-dependent manner.
11889131 2002 Clustering induces redistribution of syndecan-4 core protein into raft membrane domains.
11805099 2002 Syndesmos, a syndecan-4 cytoplasmic domain interactor, binds to the focal adhesion adaptor proteins paxillin and Hic-5.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11567105 2001 Heparin binding by the HIV-1 tat protein transduction domain.
11549250 2001 Syndecan-4 as antithrombin receptor of human neutrophils.
11456484 2001 Solution structure of the dimeric cytoplasmic domain of syndecan-4.
11024024 2001 Internalization of HIV-1 tat requires cell surface heparan sulfate proteoglycans.
10911369 2000 Synectin, syndecan-4 cytoplasmic domain binding PDZ protein, inhibits cell migration.
10497173 1999 Multiple interactions of HIV-I Tat protein with size-defined heparin oligosaccharides.
9660868 1998 Human CASK/LIN-2 binds syndecan-2 and protein 4.1 and localizes to the basolateral membrane of epithelial cells.
9582338 1998 Solution structure of a syndecan-4 cytoplasmic domain and its interaction with phosphatidylinositol 4,5-bisphosphate.
9556568 1998 Regulation of syndecan-4 phosphorylation in vivo.
9342064 1997 HIV-1 Tat protein exits from cells via a leaderless secretory pathway and binds to extracellular matrix-associated heparan sulfate proteoglycans through its basic region.
9169435 1997 Regulated shedding of syndecan-1 and -4 ectodomains by thrombin and growth factor receptor activation.
9111037 1997 Interaction of HIV-1 Tat protein with heparin. Role of the backbone structure, sulfation, and size.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8797100 1996 Structural organization and promoter activity of the human ryudocan gene.
8621465 1996 Human ryudocan from endothelium-like cells binds basic fibroblast growth factor, midkine, and tissue factor pathway inhibitor.
8570206 1996 HIV-tat protein is a heparin-binding angiogenic growth factor.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8019004 1994 Syndecan 4 heparan sulfate proteoglycan is a selectively enriched and widespread focal adhesion component.
7916598 1993 Human ryudocan core protein: molecular cloning and characterization of the cDNA, and chromosomal localization of the gene.
7690138 1993 The Tat protein of human immunodeficiency virus type 1, a growth factor for AIDS Kaposi sarcoma and cytokine-activated vascular cells, induces adhesion of the same cell types by using integrin receptors recognizing the RGD amino acid sequence.
7626103 1995 Molecular cloning of the human ryudocan promoter.
1500433 1992 Molecular cloning of amphiglycan, a novel integral membrane heparan sulfate proteoglycan expressed by epithelial and fibroblastic cells.