Property Summary

NCBI Gene PubMed Count 34
PubMed Score 73.26
PubTator Score 40.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.700 4.9e-03
sonic hedgehog group medulloblastoma -1.300 6.2e-04
astrocytoma 2.800 1.2e-02
medulloblastoma, large-cell -2.900 3.9e-05
active ulcerative colitis 1.252 3.3e-03
pilocytic astrocytoma 1.300 1.2e-04
Gaucher disease type 1 1.300 3.5e-02

Gene RIF (32)

PMID Text
25617766 Syndecan-3 and TFPI colocalize on the surface of endothelial-, smooth muscle-, and cancer cells
24956062 Data indicate that the extracellular and cytoplasmic domains of syndecans 1/2/3/4 are intrinsically disordered regions.
24659893 frequently expressed in pancreatic cancer and associated with perineural invasion
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of syndecan 3 (SDC3) in peptide-treated PBMCs
23351331 Syndecan-3 expression was not associated with disease progression and outcome in specific subtypes of mammary carcinoma.
22721673 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of syndecan 3 (SDC3) in peptide-treated PBMCs
21555518 SDC3 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
21200028 Syndecan-3 may directly transduce Glial cell line-derived neurotrophic factor (GDNF) family ligands (GFL) signals or serve as a coreceptor, presenting GFLs to the signaling receptor RET.
21050724 Observational study of gene-disease association. (HuGE Navigator)
19822079 Data report that the bFGF, FGFR1/2 and syndecan 1-4 expressions are altered in bladder tumours.
19820907 These findings indicate that SDC3 polymorphisms could contribute to the link between female hyperandrogenism and obesity and suggest a novel potential role for SDC3 as a modulator of gonadal steroid function.
19820907 Observational study of gene-disease association. (HuGE Navigator)
18716876 found in 57.9% of pancreatic ductal carcinoma specimens
18599487 pleiotrophin (PTN) and syndecan-2 and -3 as direct binding partners of Y-P30.
18093920 syndecan TMD homodimerization and heterodimerization can be mediated by GxxxG motifs and modulated by sequence context
18040049 Syndecan-3 was identified as a major HIV-1 attachment receptor on DCs.
17368428 Midkine, pleiotrophin (PTN), and their receptors syndecan-3 and receptor protein tyrosine phosphatase beta/zeta, were highly expressed in the striatum during developmen
17018662 Observational study of gene-disease association. (HuGE Navigator)
17018662 There are ethnic differences in the SDC3 polymorphisms, and the polymorphisms are strongly associated with obesity.
16817962 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of syndecan 3 (SDC3) in peptide-treated PBMCs
16674815 The high expression of syndecan 3 and its localization to the smooth muscle bundles during normal labour, together with the significant reduction in prolonged labour, may indicate a role for this protein in the co-ordination of myometrial contractility.
16157597 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of syndecan 3 (SDC3) in peptide-treated PBMCs
16052590 Selective induction of CXCL8 binding site on endothelial syndecan-3 in rheumatoid arthritis(RA) synovium. This site may be involved in leukocyte trafficking into RA synovial tissue.
12885232 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of syndecan 3 (SDC3) in peptide-treated PBMCs
11968010 Augmented synthesis and differential localization of heparan sulfate proteoglycans in Duchenne muscular dystrophy.
11567105 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of syndecan 3 (SDC3) in peptide-treated PBMCs
11024024 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of syndecan 3 (SDC3) in peptide-treated PBMCs
10497173 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of syndecan 3 (SDC3) in peptide-treated PBMCs
9342064 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of syndecan 3 (SDC3) in peptide-treated PBMCs
9111037 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of syndecan 3 (SDC3) in peptide-treated PBMCs
8570206 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of syndecan 3 (SDC3) in peptide-treated PBMCs
7690138 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of syndecan 3 (SDC3) in peptide-treated PBMCs

AA Sequence

MKPGPPHRAGAAHGAGAGAGAAAGPGARGLLLPPLLLLLLAGRAAGAQRWRSENFERPVDLEGSGDDDSF      1 - 70
PDDELDDLYSGSGSGYFEQESGIETAMRFSPDVALAVSTTPAVLPTTNIQPVGTPFEELPSERPTLEPAT     71 - 140
SPLVVTEVPEEPSQRATTVSTTMATTAATSTGDPTVATVPATVATATPSTPAAPPFTATTAVIRTTGVRR    141 - 210
LLPLPLTTVATARATTPEAPSPPTTAAVLDTEAPTPRLVSTATSRPRALPRPATTQEPDIPERSTLPLGT    211 - 280
TAPGPTEVAQTPTPETFLTTIRDEPEVPVSGGPSGDFELPEEETTQPDTANEVVAVGGAAAKASSPPGTL    281 - 350
PKGARPGPGLLDNAIDSGSSAAQLPQKSILERKEVLVAVIVGGVVGALFAAFLVTLLIYRMKKKDEGSYT    351 - 420
LEEPKQASVTYQKPDKQEEFYA                                                    421 - 442
//

Text Mined References (35)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25617766 2015 Syndecan-3 and TFPI colocalize on the surface of endothelial-, smooth muscle-, and cancer cells.
24956062 2015 Cell communication using intrinsically disordered proteins: what can syndecans say?
24659893 2014 Midkine promotes perineural invasion in human pancreatic cancer.
23395182 2013 The structure of the Tiam1 PDZ domain/ phospho-syndecan1 complex reveals a ligand conformation that modulates protein dynamics.
23351331 2013 Prognostic significance of the expression of GFR?1, GFR?3 and syndecan-3, proteins binding ARTEMIN, in mammary carcinoma.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21200028 2011 Heparan sulfate proteoglycan syndecan-3 is a novel receptor for GDNF, neurturin, and artemin.
21050724 2011 Clock genes and body composition in patients with schizophrenia under treatment with antipsychotic drugs.
19822079 Expression of basic fibroblast growth factor, its receptors and syndecans in bladder cancer.
19820907 2009 Role of syndecan-3 polymorphisms in obesity and female hyperandrogenism.
18716876 2009 Pleiotrophin expression in human pancreatic cancer and its correlation with clinicopathological features, perineural invasion, and prognosis.
18599487 2008 The survival-promoting peptide Y-P30 enhances binding of pleiotrophin to syndecan-2 and -3 and supports its neuritogenic activity.
18093920 2007 Transmembrane domains of the syndecan family of growth factor coreceptors display a hierarchy of homotypic and heterotypic interactions.
18040049 2007 Syndecan-3 is a dendritic cell-specific attachment receptor for HIV-1.
17368428 2007 Role of heparin binding growth factors in nigrostriatal dopamine system development and Parkinson's disease.
17018662 2006 Positive association of obesity with single nucleotide polymorphisms of syndecan 3 in the Korean population.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16674815 2006 Prolonged labour associated with lower expression of syndecan 3 and connexin 43 in human uterine tissue.
16052590 2005 Induction of a CXCL8 binding site on endothelial syndecan-3 in rheumatoid synovium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14504279 2003 Syndecan 3 intramembrane proteolysis is presenilin/gamma-secretase-dependent and modulates cytosolic signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11968010 2002 Augmented synthesis and differential localization of heparan sulfate proteoglycans in Duchenne muscular dystrophy.
11751872 2002 Schwann cell adhesion to a novel heparan sulfate binding site in the N-terminal domain of alpha 4 type V collagen is mediated by syndecan-3.
11527150 2001 Cloning and characterization of human syndecan-3.
10460248 1999 Regulated expression and subcellular localization of syndecan heparan sulfate proteoglycans and the syndecan-binding protein CASK/LIN-2 during rat brain development.
9553134 1998 Cortactin-Src kinase signaling pathway is involved in N-syndecan-dependent neurite outgrowth.
9455484 1997 Characterization of cDNA clones in size-fractionated cDNA libraries from human brain.
9388509 1997 Phosphorylation of recombinant N-syndecan (syndecan 3) core protein.
9089390 1997 Expression of syndecan-1 and -3 during embryogenesis of the central nervous system in relation to binding with midkine.
8662884 1996 Schwann cells secrete a novel collagen-like adhesive protein that binds N-syndecan.
8344959 1993 N-syndecan (syndecan 3) from neonatal rat brain binds basic fibroblast growth factor.
8175719 1994 Isolation of a neuronal cell surface receptor of heparin binding growth-associated molecule (HB-GAM). Identification as N-syndecan (syndecan-3).
1556152 1992 Molecular cloning and characterization of N-syndecan, a novel transmembrane heparan sulfate proteoglycan.