Property Summary

NCBI Gene PubMed Count 270
PubMed Score 1682.04
PubTator Score 901.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
nephrosclerosis -1.940 1.6e-02
malignant mesothelioma 1.300 9.9e-06
psoriasis -1.200 1.5e-04
osteosarcoma -2.830 2.3e-06
ependymoma 1.400 1.1e-03
glioblastoma 2.100 8.4e-04
cystic fibrosis 1.402 1.6e-04
atypical teratoid / rhabdoid tumor 2.000 1.3e-06
medulloblastoma, large-cell 1.700 8.0e-04
primitive neuroectodermal tumor 2.100 2.7e-03
primary pancreatic ductal adenocarcinoma 1.410 2.9e-02
non-small cell lung cancer 1.801 1.0e-20
intraductal papillary-mucinous adenoma (... 1.800 9.8e-03
intraductal papillary-mucinous carcinoma... 2.000 3.3e-03
intraductal papillary-mucinous neoplasm ... 2.600 2.9e-03
pancreatic cancer 1.900 1.8e-09
breast carcinoma 1.800 5.7e-03
fibroadenoma 2.200 4.1e-02
interstitial cystitis -2.000 4.1e-04
pediatric high grade glioma 1.800 7.2e-05
sonic hedgehog group medulloblastoma 1.100 3.2e-02
lung adenocarcinoma 1.500 2.0e-07
invasive ductal carcinoma 3.600 4.6e-03
inflammatory breast cancer 2.100 5.9e-03
lung carcinoma -1.100 2.1e-20
spina bifida -1.671 3.2e-02
ductal carcinoma in situ 3.600 1.4e-04
ovarian cancer 3.100 2.3e-04

 GWAS Trait (1)

Gene RIF (241)

PMID Text
26909794 The results suggest that Sdc1 may modulate fibronectin fibrillogenesis and/or alter cell morphology during ECM production through alphavbeta3 integrin, thereby mediating ECM fiber alignment.
26852939 Syndecan-1 on epithelial tumor cells promotes MIF binding and MIF-mediated cell migration. This may represent a relevant mechanism through which MIF enhances tumor cell motility and metastasis.
26729247 The new markers were able to identify a clonal CD138-negative population as minimal residual disease in the bone marrow and peripheral blood of MM patients.
26514209 miR-145 suppresses syndecan-1 and, by this mechanism, up-regulates stem cell factors and induces cell senescence and differentiation.
26513873 stromal changes in the expression of SDC-1 may originate from the stroma and contribute to the pathogenesis and metastatic potential of epithelial ovarian carcinoma
26460958 Targeting Syndecan-1, a molecule implicated in the process of vasculogenic mimicry, enhances the therapeutic efficacy of the L19-IL2 immunocytokine in human melanoma xenografts.
26350464 demonstrate that HER2 is captured via a site, comprised of amino acids 210-240, in the extracellular domain of human Sdc1, and EGFR is captured via an extracellular site comprised of amino acids 87-131 in human Sdc4
26289843 HPV16 particles binds to heparan sulfate and syndecan-1 molecules present in the extracellular matrix.
26210886 SULF1 levels are lower in pleural malignancies compared to benign conditions and inversely correlate with the amounts of syndecan-1, suggesting important roles for syndecan-1 and SULF1 in malignant mesothelioma.
26191180 miR-302a plays a key role in inhibition of ovarian cancer cell proliferation, and enhancing apoptosis by targeting SDC1.
26057450 Despite presence of the HPV-receptor syndecan-1 in tongue squamous cell carcinoma (TSCC), HPV prefers the tonsillar environment.
25972509 Elevated plasma syndecan-1 levels in renal transplantation patients might be interpreted as repair/survival factor related to loss of tubular and endothelial function in transplanted kidneys.
25891890 The concentration of syndecan-1, a marker of glycocalyx damage measured during ED admission, is valuable in assessing the risk of developing AKI and in-hospital mortality.
25830352 Sdc-1 may act as a modulator of ESC apoptosis and probably invasion depth as a crucial factor for successful pregnancy.
25757215 syndecan-1 has a role in glycocalyx shedding and is increased in patients with end-stage liver disease; ischemia-reperfusion injury during OLT further exacerbates glycocalyx shedding
25732677 our findings identify heparanase as a modulator of the syndecan-syntenin-ALIX pathway, fostering endosomal membrane budding and the biogenesis of exosomes by trimming the heparan sulfate chains on syndecans
25662098 This paper provides evidence of alternative binding of IL-34 to chondroitin sulphates and syndecan-1 at the cell surface that modulates M-CSFR activation.
25589885 Syndecan-1 expression is associated with tumor size and EGFR expression in colorectal carcinoma
25512478 Serum SDC-1 levels are increased in systemic lupus erythematosus patients with nephritis, indicating that SDC-1 might be a useful serum biomarker for active LN.
25462564 Syndecan-1 responsive microRNA-126 and 149 regulate cell proliferation in prostate cancer
25404732 this work has broad implications beyond myeloma because shed syndecan-1 is present in high levels in many tumor types as well as in other disease states.
25361632 A significant association between SDC1 and breast cancer was identified.
25353275 Our study indicates that SDC1 expressed by the bone marrow microenvironment is involved in angiogenesis in MM.
25344834 High expression of SDC1 is associated with dedifferentiated liposarcoma tumorigenesis.
25321193 High Syndecan-1 expression is associated with chemotherapy resistance in colorectal cancer.
25274915 The levels of expression of VEGF and syndecan-4 mRNAs were significantly and positively correlated in cartilage explant but not in cultured chondrocytes
25273930 syndecan-1 may have a role as a biological and prognostic marker in patients with triple-positive breast carcinomas
25267953 bFGF, SD1 and TNF-alpha are significantly reduced in Crohn's disease patients in deep remission under treatment with anti-TNFalpha, likely as an expression of optimal control of inflammation.
25236603 PKC-mediated syndecan-1 downregulation causes loss of cell invasiveness in melanoma cells under anchorage independency
25202019 Sdc1 is required for HER2-mediated activation of the alpha6beta4 integrin in wound healing assays or tumor cell survival.
25198673 syndecan-1(+) cell syncytia and excess GAG production recapitulate elements of the invertebrate encapsulation reaction, itself dependent on insect transglutaminase and glutaminated early response proteins
25147801 syndecan-1 in pleural effusions predicted a survival difference for patients with pleural metastatic disease and malignant mesothelioma.
25120060 Syndecan-1 is involved in morphogenesis of the developing tooth crown and cervical loops, andntogether with CK8 and vimentin in differentiation of preameloblasts and preodontoblasts.
25115297 Elevated levels of soluble CD138/Sdc-1 in older bladder cancer patients and those with muscular invasion sheds some light on the mechanisms of the disease invasion.
25017879 Increased syndecan-1 expression levels may indicate a high degree of differentiation, an early clinical stage and a favorable prognosis of malignant gastric cardiac adenocarcinoma.
24982376 In DCIS of different nuclear grades, tissue localization of syndecan-1 is significantly divergent, suggesting a specific effect on biology and progression of DCIS.
24970903 Syndecan 1 mRNA expression did not vary between chronic diverticulitis and Crohn's disease.
24957789 HO-1, S100A4, and SYND1 expressions have prognostic value in primary non-muscle-invasive bladder cancer (NMIBC).
24956062 Data indicate that the extracellular and cytoplasmic domains of syndecans 1/2/3/4 are intrinsically disordered regions.
24762495 Expression decreased with the decreasing grades of dysplasia. Syndecan-1 can be efficiently used in early detection and diagnosis of oral carcinoma.
24751902 Heptatitis c virus uses apoE-SDC4 interactions to enter hepatoma cells and establish infection.
24722758 this study revealed a link between miRNA-143 and Syn-1 in the pathogenesis of melanoma.
24656090 Presence of SDC1 in tumor stroma is an independent risk factor for patient survival in bladder cancer
24549646 Syndecan-1 (CD138) contributes to prostate cancer progression by stabilizing tumour-initiating cells.
24524203 Urinary levels and cellular localization of syndecan-1 are associated with differentiation status of patients with bladder cancer.
24424718 It is concluded that increased SNAIL levels in advanced PC are associated with low expression of syndecan 1
24392029 Syndecan-1 modulates the cancer stem cell phenotype via regulation of the Wnt and IL-6/STAT3 signaling pathways
24388357 Transfection of chimeric anti-CD138 gene enhances natural killer cell activation and killing of multiple myeloma cells.
24283919 SD1 mRNA levels do not differ between resected colon samples of patients with acute colonic diverticulites and ileocolonic Crohn's disease.
24222257 placental expression decreased in pre-eclampsia, independent of labor, gestational age, birthweight centile
24145151 Chemotherapy stimulates syndecan-1 shedding: a potentially negative effect of treatment that may promote tumor relapse.
24045542 Syndecan-1 overexpression is associated with nonluminal subtypes and poor prognosis in advanced breast cancer.
24029663 Data indicate that the CD138int follicular B cells were clearly distinct from plasma cells.
23991032 Data indicate that biochemical markers significantly associated with mesothelioma were hyaluronan, N-ERC/mesothelin and syndecan-1.
23988031 Results suggest that small subsets of circulating CD30+/CD15+ cells expressing FGF2 and SDC1 represent biomarkers that identify NS-cHL patients who will experience a poor outcome.
23888783 Comparative characteristics of the structure and function for syndecan-1 from animal organisms
23729443 Through phenotype analysis, non-HAV-specific antibody-secreting cells are found to be Ki-67lowCD138highCD31highCD38high compared with HAV-specific ASCs.
23728345 results indicate that angiogenesis induced by radiotherapy is associated with an MMP-9-miR-494-SDC1 regulatory loop
23576506 Our studies demonstrates that SDC1 is the major receptor protein for HCV attachment.
23570784 High syndecan-1 levels in acute myeloid leukemia are associated with bleeding, thrombocytopathy, endothelial cell damage, and leukocytosis.
23553620 SDC1 expression is associated with N stage and the status of resection margin involvement in squamous cell carcinoma (SCC) of the tonsil.
23546957 Data indicate that desmoplakin (DSP) and cystatin A (CSTA) interaction and insulin-like growth factor 1 (IGF-1), IGF-binding protein 7 (IGFBP7) and syndecan 1 (SDC1) interaction were observed in protein-protein interaction (PPI) network.
23545927 The assessment of syndecan-1 and Ki-67 expression in skin biopsies is a helpful tool for differentiating keratoacanthoma and squamous cell carcinoma
23511033 Elevation of serum SDC1 is associated with Crohn's disease.
23504321 Targeting of heparanase-modified syndecan-1 by prosecretory mitogen lacritin requires conserved core GAGAL plus heparan and chondroitin sulfate as a novel hybrid binding site that enhances selectivity.
23431957 SDC1 expression was not different in patients with advanced vs no/limited LBD.A significant positive correlation between gene expression & BM plasma protein levels was observed for SDC1.
23408834 The DNA methylome of CD138-positive cells from 56 subjects representing premalignant (monoclonal gammopathy of uncertain significance), early, and advanced stages of myeloma, as well as healthy controls, is characterized.
23331867 IGF1R coupled with Sdc1 is required for activation of the alphaVbeta3 integrin and for VEGFR2 signalling.
23289672 Sdc-1 silencing promotes increased MDA-MB-231 cell migration via a beta1-integrin-dependent mechanism.
23206733 Syndecan-1, a target of miR-10b, inhibits epithelial endometriotic cell invasiveness through down-regulation of metalloproteinase activity and interleukin-6.
23144729 Data indicate that Syndecan-1 silencing had less powerful effect on the transcriptome compared to overexpression.
23066085 findings demonstrate that 15-LOX-1-mediated metabolism of DHA is required for it to upregulate SDC-1 and trigger the signaling pathway that elicits apoptosis in prostate cancer cells
22994707 Positive expression of BCL-6, CD10, CD138 and MUM-1 was shown in 78%, 61%, 39% and 91% of the cases.
22936802 the lung epithelium requires the syndecan-1 transmembrane domain to govern cell migration and is independent from its ability to control cell adhesion via the extracellular domain.
22905270 Novel processed form of syndecan-1 shed from SCC-9 cells plays a role in cell migration
22899717 Syndecan-1 alters the dynamic exchange of adhesion complex proteins, which in turn regulates migration speed.
22766978 observations suggest that low CD138 expression in multiple myeloma cells relates to poor prognosis, immature phenotype and low sensitivity to lenalidomide
22745764 Report demonstrates that syndecan-1 enhances malignancy of a mesenchymal tumour cell line, via induction of syndecan-2 expression.
22714920 the increased expression of syndecan-1 at gene and protein levels is correlated with advanced tumor progression and poor outcome in patients with glioma. Syndecan-1 might serve as a potential prognosis predictor of this dismal tumor.
22686587 The loss of syndecan-1 expression in the epithelial cell membrane is associated with tumor cell growth and invasiveness
22680042 Mucosal TNF-alpha is overexpressed only in symptomatic diverticular disease, while SD1 and bFGF are already overexpressed in asymptomatic diverticulosis.
22673509 study adds new components to the multi-dentate membrane targeting mechanism and highlights the role of N- and C-terminal PDZ extensions of PSD-95/ZO-1 in the regulation of syntenin-1 plasma membrane localization
22672327 Data indicate that immune-magnetic CD138-positive cell sorting significantly increased the percentage of abnormal cells identified in FISH analysis of multiple myeloma (MM) samples.
22629140 We conclude that serum levels of HGF, OPN, and SYN correspond to the activity of MM and might become useful in differentiation of MGUS, asymptomatic MM, and overt/symptomatic form of MM.
22573479 syndecan-1 is a novel target of the oncomiR miR-10b.
22418956 Placental syndecan-1 expression is associated with premature birth and fetal growth.
22351752 the LAMA3 LG45 domain may trigger different signals toward keratinocytes depending on its interaction with syndecan-1 or -4.
22338054 CD138 reactivity for neoplastic cells in bone is not a definitive marker for plasmacytic origin.
22308310 Our results demonstrate that syndecan plays a negative role in death receptor-mediated cell death
22298773 Heparan sulfate chains of syndecan-1 regulate ectodomain shedding.
22238310 Syndecan 1 and syndecan 2 are cellular molecules responsible for susceptibility to HTLV-1.
22237752 Syndecan-1 expression was increased in tubular epithelial cells in allografts. Increased syndecan-1 in allografts correlated with low proteinuria and serum creatinine, less interstitial inflammation, less tubular atrophy and prolonged graft survival.
22150439 We found increased vascular adhesion protein 1 activity and anchor protein syndecan-1 content in critically ill patients with septic shock
22102278 Heparanase and syndecan-1 interplay orchestrates fibroblast growth factor-2-induced epithelial-mesenchymal transition in renal tubular cells.
22024722 results suggest that syndecan-1 may contribute to the highly angiogenic phenotype of MMECs by promoting EC proliferation, survival and modulating VEGF-VEGFR-2 signalling
21957484 a new role for syndecan-1 in HSV-1 pathogenesis
21898481 Syndecan-1 mediates hepatic VLDL turnover in humans as well as in mice and shedding might contribute to hypertriglyceridemia in patients with sepsis.
21886795 These data suggest that plasma based resuscitation preserved endothelial syndecan-1 and maintained endothelial integrity.
21772125 In trauma patients, high circulating syndecan-1, a marker of endothelial glycocalyx degradation, is associated with inflammation, coagulopathy and increased mortality.
21757697 Heparanase-mediated loss of nuclear syndecan-1 enhances histone acetyltransferase (HAT) activity to promote expression of genes that drive an aggressive tumor phenotype
21731601 syndecan-1 regulates mesenchymal tumor cell adhesion and migration, and different domains have differential effects.
21630196 CD138 may contribute to the differential diagnosis of renal tumors
21623993 Syndecan-1 is up-regulated in BeWo cells during differentiation and its silencing inhibits syncytialization.
21463121 Findings show significant correlations between MMP-2, -9, and syndecan-1 and hemostatic parameters in hematologic malignancies, in contrast, the MMP inhibitors, TIMP1- and -2, were not correlated with any of the hemostatic parameters.
21454203 In conclusion, CD138 expression may constitute an additional aid in the distinction between WM and SMZL.
21430259 There was a statistical relationship between syndecan-1 presence in high-grade tumors and absence of syndecan-4, whereas syndecan-4 presence in cases positive for estrogen and progesterone receptor associated with syndecan-1 absence
21414405 Syndecan-1 and -4 differentially regulate oncogenic K-ras dependent cell invasion
21334435 Extracellular superoxide dismutase protects cardiovascular syndecan-1 from oxidative shedding and prevents from its subsequent induction of fibroblast proliferation.
21327984 A multiple regression analysis showed that BMI (beta = 0.783, P < 0.000) was a significant predictor of positive syndecan-1 neutrophils in subjects with type 2 diabetes.
21320038 sCD138 may be applicable as a surrogate marker of disease activity.
21317913 In benign samples, syndecan-1 was expressed in basal and secretory epithelial cells with basolateral membrane localisation. In prostate cancer samples syndecan 1 was expressed to granular-cytoplasmic localisation.
21265098 High glucose can decrease the expression of core protein Sydecan-1 and Glypican-1 in cultured human renal glomerular endothelial cells.
21257720 SST0001, a chemically modified heparin, inhibits myeloma growth and angiogenesis via disruption of the heparanase/syndecan-1 axis
21148276 These results demonstrate that syndecan-1 and syndecan-2 gene silencing by RNA interference reduces HSV-1 entry, plaque formation and facilitates cell survival.
21114861 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
20971705 couples the insulin-like growth factor-1 receptor to inside-out integrin activation
20927321 Loss of SDC-1 is associated with prostate cancer.
20736897 A threshold of greater than six CD138+ metabolically active plasma cells is associated with poor kidney allograft function and survival.
20683626 multiple regression analysis showed that apolipoprotein A1 was a predictor of serum syndecan-1 levels in subjects with type 2 diabetes
20598296 The syndecan- and alpha2beta1 integrin-binding peptides synergistically affect cells and accelerate cell adhesion.
20477813 The prognostic value of intraepithelial and stromal CD3-, CD117- and CD138-positive cells in non-small cell lung carcinoma.
20471559 This study confirms a direct relationship between suprabasal p35 localization together with down-regulation of syndecan-1 immunoexpression and dysplastic changes of oral lichen planus and hence the possibility for malignant transformation.
20430722 Results suggest a role for syndecan-1 and cathepsins D and K in growth and invasiveness of esophageal squamous cell carcinoma.
20398359 Expression of syndecan 1 in healthy breast tissue during menstrual cycle.
20361982 Cell biological analysis established that Syndecan1 is a physiological binding partner of Tiam1 and that the PDZ domain has a function in cell-matrix adhesion and cell migration.
20307537 The presence of a less mature, more resistant CD138-negative myeloma cell fraction within bone marrow microniches might contribute to high incidence of relapse of myeloma patients.
20237901 Laminin-derived peptide AG73 regulates migration, invasion, and protease activity of human oral squamous cell carcinoma cells through syndecan-1 and beta1 integrin.
20204274 Syndecan-1 and versican expression status can serve as an indicator of prognosis in patients with epithelial ovarian cancer.
20200931 Syndecan-1 shed by tumor cells exerts biologic effects distal to the primary tumor and that it participates in driving osteoclastogenesis and the resulting bone destruction.
20193112 Decreased expression of Syndecan-1 mRNA and the increased expression of HPA-1 mRNA can promote the invasion and metastasis of colorectal cancer.
20097882 pathway driven by heparanase expression in myeloma cells: elevated levels of VEGF and shed syndecan-1 form matrix-anchored complexes that together activate integrin and VEGF receptors on adjacent endothelial cells thereby stimulating tumor angiogenesis
20083849 all syndecans can interact with proteins of the actin-associated cytoskeleton--REVIEW
20081059 Age-associated study of detailed characterization of circulating CD138-negative and CD138-positive plasma cells sorted by flow cytometry shows a typical plasma cell cytology with no obvious morphological differences.
20036233 Data substantiate the existence of a co-adhesion receptor system in tumor cells, whereby Sdc1 functions as a key regulator of cell motility and cell invasion by modulating RhoA and Rac activity.
20013319 High CD138 serum levels are associated with B-chronic lymphocytic leukemia progression.
20008145 Sdc1 has a protective effect during experimental colitis.
19875451 ADAM17 may therefore be an important regulator of syndecan functions on inflamed lung epithelium.
19866343 higher proportion of protein-expressing B-cells in the blood of patients with systemic lupus erythematosus
19860843 syndecan-1 might contribute to urothelial carcinoma cell survival and progression
19859083 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
19822079 Data report that the bFGF, FGFR1/2 and syndecan 1-4 expressions are altered in bladder tumours.
19802384 syndecan-1 and FGF-2, but not FGFR-1 share a common transport route and co-localize with heparanase in the nucleus, and this transport is mediated by the RMKKK motif in syndecan-1
19735958 Chronic inflammation and exogenous insulin usage increases the serum syndecan-1 level in type 2 diabetics.
19696445 syndecan 1 and 4 correlate to increased metastatic potential in melanoma patients and are an important component of the Wnt5A autocrine signaling loop
19661268 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
19632304 Study indicates that SDC-1 and -4 may be required for HepG2, Hep3B and Huh7 human hepatoma cell migration, invasion or spreading induced by the chemokine.
19596856 the effects of syndecan-1 on myeloma survival, growth, and dissemination are due, at least in part, to its positive regulation of tumor-host interactions that generate an environment capable of sustaining robust tumor growth.
19581738 Ressutls show that cystic tumors of the pancreas express syndecan-1 and tenascin differently and suggest that low syndecan-1 expression might serve as a predictive factor for malignancy.
19473447 Results showed that epithelial syndecan-1 expression is reduced as lip carcinogenesis progresses (normal tissue>actinic cheilitis>lip squamous cell carinoma), suggesting that syndecan-1 could be a useful marker of malignant transformation in the lip.
19456850 syndecan-1 is a co-receptor for APRIL and TACI at the cell surface of MMC, promoting the activation of an APRIL/TACI pathway that induces survival and proliferation in multiple myeloma cells
19450993 changes in the pattern expression of syndecan-1 and -2 indicate that both molecules may be involved in the epithelial-mesenchymal transition (EMT) and tumor progression of prostate cancer.
19420730 reduced syndecan-1/E-cadherin expression may be good indicators of recurrence and prognosis in extrahepatic bile duct carcinoma.
19351365 The present results suggest that the decrease in syndecan-1 expression and increase in the Ki-67 index observed in ameloblastic carcinomas is in accordance with its higher aggressiveness as compared to the rare desmoplastic and peripheral ameloblastomas.
19305494 Results show that heparanase alters the level of nuclear syndecan-1.
19255147 The active site within the Sdc1 core protein was identified and a peptide inhibitor called synstatin (SSTN) that disrupts Sdc1's interaction with alpha(v)beta(3) and alpha(v)beta(5) integrins was derived.
19251947 Shed syndecan-1 restricts neutrophil elastase from alpha1-antitrypsin in neutrophilic airway inflammation.
19228696 Data show that syntenin-1 binds to syndecan-1 and participates in the formation of membrane protrusions, and that syntenin-1 recruitment depends on the dephosphorylation of Tyr-309 located within syndecan-1 PDZ binding domain EFYA.
19126645 Proteolytic conversion of Sdc1 from a membrane-bound into a soluble molecule marks a switch from a proliferative to an invasive phenotype, with implications for breast cancer diagnostics and potential glycosaminoglycan-based therapies.
19107206 Observational study of gene-disease association. (HuGE Navigator)
19073610 Oxidative shedding of syndecan-1 is an underlying cause of neutrophil chemotaxis and aberrant wound healing that may contribute to pulmonary fibrosis.
19029267 Plasma levels of syndecan-1 increased significantly during coronary artery bypass grafting, with or without the use of cardiopulmonary bypass.
19020713 syndecan-1 directly contributes to the growth and invasive ability of oral cancer cells
19010933 Membrane type 1 matrix metalloproteinase-mediated stromal syndecan-1 shedding stimulates breast carcinoma cell proliferation.
18997617 Expression of Galectin-3, CD138, p16INK4a, and TTF-1 in mucinous bronchioloalveolar adenocarcinoma after Hodgkin lymphoma.
18976975 Knockdown of syndecan 1 (SDC1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18957427 Rab5 is a critical regulator of syndecan-1 shedding that serves as an on-off molecular switch through its alternation between the GDP-bound and GTP-bound forms.
18694404 CD138 is a new simple non-invasive marker for predicting liver fibrosis in patients with chronic hepatitis C.
18657535 Our findings thus suggest that a previously unknown link between integrin alpha2beta1 and syndecan-1 is important in regulating cell adhesion to collagen and in triggering integrin downstream signalling.
18542065 loss of syndecan-1 epithelial expression was of strong prognostic value in breast carcinomas
18450755 syndecan 1 is up-regulated by n-3 fatty acids by a transcriptional pathway involving PPARgamma
18450428 In vitro reconstructed normal human epidermis expresses differentiation-related proteoglycans (CD44, syndecan-1, desmosealin, and 7C1).
18413760 n-3 polyunsaturated fatty acids (n-3 PUFA) upregulate SDC1 in breast cancer cellsbu activating PPARgamma, providing a chemopreventive effect.
18386024 aberrant skin expression may be involved in the development of psoriasis
18378436 Syndecan-1 and beta1 integrin signaling downstream of laminin alpha1-derived peptide AG73 regulate adhesion and MMP production by human salivary gland tumor cell lines (CAC2 and M1).
18190591 the association of circulating sCD138 levels in plasma with clinical behavior in 104 patients with chronic lymphocytic leukemia
18093920 syndecan TMD homodimerization and heterodimerization can be mediated by GxxxG motifs and modulated by sequence context
18064305 heparan sulfate and syndecan-1, the predominant intestinal epithelial heparan sulfate proteoglycan, are essential in maintaining intestinal epithelial barrier function.
18006945 Results indicate a lack of association between SDC-1 polymorphisms and risk of squamous cell carcinomas of the cervix.
17625591 syndecan-1 regulates keratinocyte proliferation differently during skin development and in healing wounds.
17579341 SDC1 interaction with the LG4/5 domain in kalinin is essential for keratinocyte migration.
17455248 upregulation of syndecan-1 may be a critical element for endometrial cancers in maintaining their viability
17431390 Decreased syndecan-1 is asociated with thyroid cancer
17413980 In summary, ovarian carcinomas exhibit up-regulated expression of several extracellular matrix proteins, and syndecan 1 represents a novel tumor-associated marker in ovarian serous carcinomas.
17339423 Heparanase influences expression and shedding of syndecan-1
17314405 domain V of the gamma2 chain negatively regulates the integrin beta4 phosphorylation, probably through a syndecan-1-mediated signaling, leading to enhanced cell adhesion and suppressed cell motility
17149710 Syndecan-1 expression is uniquely influenced by changes in the phase and magnitude of the local stress field.
16982797 Lacritin targets the deglycanated core protein of SDC1 and not HS chains or SDC2 or SDC4. Binding requires partial or complete removal of HS chains by endogenous HPSE. This limits lacritin activity to HPSE release sites as an HPSE 'off/on switch'.
16945147 the endocytic path taken by Syn-1 is clathrin-independent and relies upon lipid raft function
16934308 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
16884912 syndecan-1 shedding may modulate the pathogenesis of specific microbes
16857657 increase of Syndecan-1 in all tissue compartments and a redistribution from epithelium to stroma may be a characteristic feature for dense breast tissue
16840194 syndecan-1 may have a role in progression of B-cell chronic lymphocytic leukemia
16817962 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
16778379 CD138 may have a role in progression of nodal diffuse large B cell lymphoma
16773719 Certain immunomarkers like syndecan-1, kappa and lambda light chains and IgA heavy chain could be of much help in identifying early stage immunoproliferative small intestinal disease (IPSID).
16720645 The ectodomain of the syndecan-1 core protein contains an active site that assembles into a complex with the alphavbeta5 integrin and regulates alphavbeta5 integrin activity.
16636895 Syndecan-1 and syndecan-4 may have roles in progression of breast carcinoma
16286510 shed syndecan-1 or MMP7-syndecan-1 complexes may have roles in tumor progression
16247452 stromal fibroblast-derived Sdc1 stimulates breast carcinoma growth and angiogenesis in vivo
16157597 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
16132527 Malignant glioma cells express all types of syndecans. NF-kappaB participates in the upregulation of the syndecan-1 expression at the transcriptional level, and increased expression of syndecan-1 could associate with thrombospondin-1.
16020957 Low epithelial syndecan-1 expression was associated with a higher histological grade and a more advanced clinical stage of the colorectal cancer
15902740 Loss of syndecan-1 plays a role in the growth of G-type cancers of differentiated type gastric cancers at an early stage
15886501 Stromal syndecan-1 expression is an independent prognostic marker in pancreatic cancer, whereas epithelial syndecan-1 expression predicts better prognosis only in resectable disease.
15797855 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
15770719 Expression of paxillin and syndecan-1 in hepatocellular carcinoma(HCC) may affect its invasive and metastatic ability. May be converse correlation between expression of paxillin and syndecan-1 protein in HCC.
15743035 syndecan-1 has a role in progression of invasive breast carcinomas through the remodeling of breast cancer tissue via interaction with other extracellular matrix components
15728209 osteoprotegerin affects monocyte mi-gration and protein kinase C and phosphatidylinositol 3-kinase/Akt activation via syndecan-1.
15648090 constitutive shedding corresponding to the basal level of soluble syndecan-1 ectodomain was significantly increased when cells were stimulated with P. gingivalis lipopolysaccharide
15479743 syndecan-1 is likely to be a critical regulator of many cellular behaviors that depend on activated alpha(v)beta(3) integrins
15459490 Concomitant expression of syndecan-1 in both epithelium and stroma may be a predictor of unfavourable prognosis in breast cancer, and in contrast with previous studies, loss of epithelial syndecan-1 was associated with a more favourable prognosis
15383330 Altered matrix-dependent signaling due to increased levels of cell surface syndecan-1 may lead to epithelial cell invasion during early stages of tumorigenesis.
15297422 syndecan-1 and glypican-1 have roles in progression of ovarian cancer
15126321 in hyperinflammatory lesions, ephrinB2 was predominantly expressed in macrophage-like cells and EphB4 in small venules; syntenin and syndecan-1 were up-regulated in EphB4-positive endothelial cells after stimulation with preclustered ephrinB2
14972511 Consistent with a possible biochemical role for syndecan-1 in prostate cancer progression and metastasis, syndecan-1 expression correlated with serologic recurrence in Gleason sum 7 prostate cancer and was highly expressed in soft-tissue metastases.
14744776 Growth-promoting loop exists between breast cancer cells and their stroma that depends on the activity of glycanated Sdc1.
14701864 MT4-MMP and the proteoglycan form of syndecan-1 have roles in ADAMTS-4 activation on the cell surface
14645569 serves as a primary human papillomavirus receptor protein in natural HPV11 infection of keratinocytes.
14630925 results demonstrate that cell-surface syndecan-1 is a degradative target of heparanase (HPSE-1), and syndecan-1 regulates HPSE-1 biological activity
12975379 the extracellular domain mediates an interaction that is necessary for dynamic cytoskeletal rearrangements whereas an interaction of the transmembrane domain is required for the initial spreading response
12947106 results demonstrate that the laminin alpha3 LG4/5 modules within unprocessed laminin-5 permit its cell binding activity through heparan and chondroitin sulfate chains of syndecan-1
12920224 The increased stromal syndecan-1 expression, coupled with its loss from the surface of carcinoma cells, may contribute to tumor cell invasion and the development of metastases
12904296 shedding of syndecan-1 promoted by MT1-MMP through the preferential cleavage of Gly245-Leu246 peptide bond stimulates cell migration
12885232 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
12879463 High syndecan-1 expression in breast carcinoma is related to an aggressive phenotype
12824007 TNF-alpha and IL-1beta are capable of down-regulating syndecan-1 expression
12749851 Cells adherent via syndecan-1 do not spread, but can be induced to spread by Mn(2+), suggesting that activation of a beta(1) or beta(3) integrin partner is required.
12660231 regulation of expression in isoform specific manner by farnesoid X receptor
12144130 review of structure, function, cell and tissue distribution
12091355 Soluble syndecan-1 promotes growth and dissemination of transplanted human myeloma tumors in vivo in SCID mice implanted with human bones.
11877089 Serum levels of soluble syndecan-1 correlated with tumor mass in patients with multiple myeloma.
11830493 mediates hepatocyte growth factor binding and promotes Met signaling in multiple myeloma
11567105 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
11168765 The loss of syndecan-1 expression evident in acantholytic conditions
11024024 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
10497173 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
9857223 The detection of syndecan-1 in endometrial cancer of different clinical and histological stages could be of prognostic value in clinical diagnosis.
9342064 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
9111037 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
8570206 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans
7690138 The V3 region (amino acids 298-329) of HIV-1 gp120 contains the syndecan-binding site for HIV-1 via 6-O sulfated motifs; a single conserved arginine (Arg-298) in the V3 region of gp120 governs HIV-1 binding to syndecans

AA Sequence

MRRAALWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQTPSTWKDTQL      1 - 70
LTAIPTSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQEATPRPRETTQLPTTHLASTT     71 - 140
TATTAQEPATSHPHRDMQPGHHETSTPAGPSQADLHTPHTEDGGPSATERAAEDGASSQLPAAEGSGEQD    141 - 210
FTFETSGENTAVVAVEPDRRNQSPVDQGATGASQGLLDRKEVLGGVIAGGLVGLIFAVCLVGFMLYRMKK    211 - 280
KDEGSYSLEEPKQANGGAYQKPTKQEEFYA                                            281 - 310
//

Text Mined References (277)

PMID Year Title
26909794 2016 Syndecan-1-Induced ECM Fiber Alignment Requires Integrin ?v?3 and Syndecan-1 Ectodomain and Heparan Sulfate Chains.
26852939 2016 Cell surface syndecan-1 contributes to binding and function of macrophage migration inhibitory factor (MIF) on epithelial tumor cells.
26729247 2016 A CD138-independent strategy to detect minimal residual disease and circulating tumour cells in multiple myeloma.
26514209 2015 microRNA-145 promotes differentiation in human urothelial carcinoma through down-regulation of syndecan-1.
26513873 2015 Syndecan-1 serves as a marker for the progression of epithelial ovarian carcinoma.
26460958 2015 Targeting Syndecan-1, a molecule implicated in the process of vasculogenic mimicry, enhances the therapeutic efficacy of the L19-IL2 immunocytokine in human melanoma xenografts.
26350464 2015 Syndecan-1 and Syndecan-4 Capture Epidermal Growth Factor Receptor Family Members and the ?3?1 Integrin Via Binding Sites in Their Ectodomains: NOVEL SYNSTATINS PREVENT KINASE CAPTURE AND INHIBIT ?6?4-INTEGRIN-DEPENDENT EPITHELIAL CELL MOTILITY.
26289843 2015 Interaction of human papillomavirus type 16 particles with heparan sulfate and syndecan-1 molecules in the keratinocyte extracellular matrix plays an active role in infection.
26210886 2015 Syndecan-1 alters heparan sulfate composition and signaling pathways in malignant mesothelioma.
26191180 2015 MiR-302a inhibits the tumorigenicity of ovarian cancer cells by suppression of SDC1.
26057450 2015 Expression of p16 in squamous cell carcinoma of the mobile tongue is independent of HPV infection despite presence of the HPV-receptor syndecan-1.
25972509 2015 Incipient renal transplant dysfunction associates with tubular syndecan-1 expression and shedding.
25891890 2015 Syndecan-1 in Acute Decompensated Heart Failure--Association With Renal Function and Mortality.
25830352 2015 Decidualization and syndecan-1 knock down sensitize endometrial stromal cells to apoptosis induced by embryonic stimuli.
25757215 2015 Alterations of Endothelial Glycocalyx During Orthotopic Liver Transplantation in Patients With End-Stage Liver Disease.
25732677 2015 Heparanase activates the syndecan-syntenin-ALIX exosome pathway.
25662098 2015 Syndecan-1 regulates the biological activities of interleukin-34.
25589885 2015 Syndecan-1 expression is associated with tumor size and EGFR expression in colorectal carcinoma: a clinicopathological study of 230 cases.
25512478 2015 Elevated serum levels of syndecan-1 are associated with renal involvement in patients with systemic lupus erythematosus.
25462564 2015 Syndecan-1 responsive microRNA-126 and 149 regulate cell proliferation in prostate cancer.
25404732 2015 Shed syndecan-1 translocates to the nucleus of cells delivering growth factors and inhibiting histone acetylation: a novel mechanism of tumor-host cross-talk.
25361632 2015 Association of heparan sulfate proteoglycans SDC1 and SDC4 polymorphisms with breast cancer in an Australian Caucasian population.
25353275 2015 Upregulation of Syndecan-1 in the bone marrow microenvironment in multiple myeloma is associated with angiogenesis.
25344834 2015 Syndecan-1 regulates adipogenesis: new insights in dedifferentiated liposarcoma tumorigenesis.
25321193 2014 Shed Syndecan-1 is involved in chemotherapy resistance via the EGFR pathway in colorectal cancer.
25274915 2014 The expression of vascular endothelial growth factor and Syndecan-4 in cartilage from osteoarthritic knees.
25273930 2014 Syndecan-1 is a potential biomarker for triple-positive breast carcinomas in Asian women with correlation to survival.
25267953 2014 Mucosal expression of basic fibroblastic growth factor, syndecan 1 and tumour necrosis factor-? in Crohn's disease in deep remission under treatment with anti-TNF? antibodies.
25236603 2014 Loss of cell invasiveness through PKC-mediated syndecan-1 downregulation in melanoma cells under anchorage independency.
25202019 2014 Cytoplasmic domain interactions of syndecan-1 and syndecan-4 with ?6?4 integrin mediate human epidermal growth factor receptor (HER1 and HER2)-dependent motility and survival.
25198673 2014 Matrix expansion and syncytial aggregation of syndecan-1+ cells underpin villous atrophy in coeliac disease.
25147801 2014 Diagnostic and prognostic value of soluble syndecan-1 in pleural malignancies.
25120060 2014 Expression of cytokeratin 8, vimentin, syndecan-1 and Ki-67 during human tooth development.
25115297 2015 Soluble CD138/Syndecan-1 Increases in the Sera of Patients with Moderately Differentiated Bladder Cancer.
25063885 2014 KSHV attachment and entry are dependent on ?V?3 integrin localized to specific cell surface microdomains and do not correlate with the presence of heparan sulfate.
25017879 2014 Midkine and syndecan?1 levels correlate with the progression of malignant gastric cardiac adenocarcinoma.
24982376 2014 Significance of syndecan-1 expression in ductal carcinoma in situ of the breast.
24970903 2014 Chronic diverticulitis and Crohn's disease share the same expression of basic fibroblastic growth factor, syndecan 1 and tumour necrosis factor-?.
24957789 2014 Prognostic significance of heme oxygenase-1, S100 calcium-binding protein A4, and syndecan-1 expression in primary non-muscle-invasive bladder cancer.
24956062 2015 Cell communication using intrinsically disordered proteins: what can syndecans say?
24762495 Immunohistochemical expression of syndecan-1 in oral dysplastic epithelium.
24751902 2014 Syndecan 4 is involved in mediating HCV entry through interaction with lipoviral particle-associated apolipoprotein E.
24722758 2014 MicroRNA-143 targets Syndecan-1 to repress cell growth in melanoma.
24656090 2014 Enhanced stromal syndecan-1 expression is an independent risk factor for poor survival in bladder cancer.
24549646 2013 Syndecan-1 (CD138) contributes to prostate cancer progression by stabilizing tumour-initiating cells.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24524203 2014 Clinical implications in the shift of syndecan-1 expression from the cell membrane to the cytoplasm in bladder cancer.
24424718 2014 Increased SNAIL expression and low syndecan levels are associated with high Gleason grade in prostate cancer.
24392029 2013 Syndecan-1 (CD138) modulates triple-negative breast cancer stem cell properties via regulation of LRP-6 and IL-6-mediated STAT3 signaling.
24388357 2014 Transfection of chimeric anti-CD138 gene enhances natural killer cell activation and killing of multiple myeloma cells.
24283919 2014 Expression of basic fibroblastic growth factor, syndecan 1 and tumour necrosis factor ? in resected acute colonic diverticulitis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24222257 2014 Placental syndecan-1 and sulphated glycosaminoglycans are decreased in preeclampsia.
24145151 2014 Chemotherapy stimulates syndecan-1 shedding: a potentially negative effect of treatment that may promote tumor relapse.
24045542 2013 Syndecan-1 overexpression is associated with nonluminal subtypes and poor prognosis in advanced breast cancer.
24029663 Reversible expression of CD138 on mature follicular B cells is downregulated by IL-4.
23991032 2013 Hyaluronan and N-ERC/mesothelin as key biomarkers in a specific two-step model to predict pleural malignant mesothelioma.
23988031 2013 Fibroblast growth factor-2 (FGF2) and syndecan-1 (SDC1) are potential biomarkers for putative circulating CD15+/CD30+ cells in poor outcome Hodgkin lymphoma patients.
23888783 [Comparative characteristics of the structure and function for syndecan-1 from animal organisms].
23729443 2013 Antibody-secreting cells with a phenotype of Ki-67low, CD138high, CD31high, and CD38high secrete nonspecific IgM during primary hepatitis A virus infection.
23728345 2014 Irradiation-induced angiogenesis is associated with an MMP-9-miR-494-syndecan-1 regulatory loop in medulloblastoma cells.
23576506 2013 Syndecan-1 serves as the major receptor for attachment of hepatitis C virus to the surfaces of hepatocytes.
23570784 2013 High syndecan-1 levels in acute myeloid leukemia are associated with bleeding, thrombocytopathy, endothelial cell damage, and leukocytosis.
23553620 2014 Prognostic significance of syndecan-1 expression in squamous cell carcinoma of the tonsil.
23546957 2013 Protein interaction and microRNA network analysis in osteoarthritis meniscal cells.
23545927 2013 Assessment of syndecan-1 (CD138) and Ki-67 expression for differentiating keratoacanthoma and squamous cell carcinoma.
23511033 2013 Syndecan-1 and heparanase: potential markers for activity evaluation and differential diagnosis of Crohn's disease.
23504321 2013 Targeting of heparanase-modified syndecan-1 by prosecretory mitogen lacritin requires conserved core GAGAL plus heparan and chondroitin sulfate as a novel hybrid binding site that enhances selectivity.
23431957 2013 Hepatocyte growth factor pathway upregulation in the bone marrow microenvironment in multiple myeloma is associated with lytic bone disease.
23408834 2013 Myeloma is characterized by stage-specific alterations in DNA methylation that occur early during myelomagenesis.
23395182 2013 The structure of the Tiam1 PDZ domain/ phospho-syndecan1 complex reveals a ligand conformation that modulates protein dynamics.
23331867 2013 Vascular endothelial-cadherin stimulates syndecan-1-coupled insulin-like growth factor-1 receptor and cross-talk between ?V?3 integrin and vascular endothelial growth factor receptor 2 at the onset of endothelial cell dissemination during angiogenesis.
23289672 2013 Syndecan-1 modulates ?-integrin-dependent and interleukin-6-dependent functions in breast cancer cell adhesion, migration, and resistance to irradiation.
23206733 2013 Targeting of syndecan-1 by micro-ribonucleic acid miR-10b modulates invasiveness of endometriotic cells via dysregulation of the proteolytic milieu and interleukin-6 secretion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23144729 2012 Novel genes and pathways modulated by syndecan-1: implications for the proliferation and cell-cycle regulation of malignant mesothelioma cells.
23066085 2013 15-Lipoxygenase-1-mediated metabolism of docosahexaenoic acid is required for syndecan-1 signaling and apoptosis in prostate cancer cells.
22994707 2012 Evaluation of BCL-6, CD10, CD138 and MUM-1 expression in diffuse large B-cell lymphoma patients: CD138 is a marker of poor prognosis.
22936802 2012 Transmembrane and extracellular domains of syndecan-1 have distinct functions in regulating lung epithelial migration and adhesion.
22905270 2012 Novel processed form of syndecan-1 shed from SCC-9 cells plays a role in cell migration.
22899717 2012 Syndecan-1 controls cell migration by activating Rap1 to regulate focal adhesion disassembly.
22766978 2012 Multiple myeloma cells expressing low levels of CD138 have an immature phenotype and reduced sensitivity to lenalidomide.
22745764 2012 Syndecan-1 enhances proliferation, migration and metastasis of HT-1080 cells in cooperation with syndecan-2.
22714920 2012 Syndecan-1 expression in human glioma is correlated with advanced tumor progression and poor prognosis.
22686587 2012 Effect of all-trans retinoic acid (ATRA) on syndecan-1 expression and its chemoprotective effect in benzo(?)pyrene-induced lung cancer mice model.
22680042 2012 Mucosal expression of basic fibroblastic growth factor, Syndecan 1 and tumor necrosis factor-alpha in diverticular disease of the colon: a case-control study.
22673509 2012 Extensions of PSD-95/discs large/ZO-1 (PDZ) domains influence lipid binding and membrane targeting of syntenin-1.
22672327 2012 Application of an immune-magnetic cell sorting method for CD138-positive plasma cells in FISH analysis of multiple myeloma.
22660413 2012 Syndecan-syntenin-ALIX regulates the biogenesis of exosomes.
22629140 2012 Prognostic value of hepatocyte growth factor, syndecan-1, and osteopontin in multiple myeloma and monoclonal gammopathy of undetermined significance.
22573479 2012 Targeting of syndecan-1 by microRNA miR-10b promotes breast cancer cell motility and invasiveness via a Rho-GTPase- and E-cadherin-dependent mechanism.
22418956 2012 Evaluation of placental syndecan-1 expression in early pregnancy as a predictive fetal factor for pregnancy outcome.
22351752 2012 Cell surface proteoglycans syndecan-1 and -4 bind overlapping but distinct sites in laminin ?3 LG45 protein domain.
22338054 2012 CD138 (syndecan-1) expression in bone-forming tumors.
22308310 2012 Removal of syndecan-1 promotes TRAIL-induced apoptosis in myeloma cells.
22298773 2012 Heparan sulfate chains of syndecan-1 regulate ectodomain shedding.
22238310 2012 Entry of human T-cell leukemia virus type 1 is augmented by heparin sulfate proteoglycans bearing short heparin-like structures.
22237752 2012 Tubular epithelial syndecan-1 maintains renal function in murine ischemia/reperfusion and human transplantation.
22150439 2012 Vascular adhesion protein-1 and syndecan-1 in septic shock.
22102278 2012 Heparanase and syndecan-1 interplay orchestrates fibroblast growth factor-2-induced epithelial-mesenchymal transition in renal tubular cells.
22024722 2012 Syndecan-1 promotes the angiogenic phenotype of multiple myeloma endothelial cells.
21957484 2011 An important role for syndecan-1 in herpes simplex virus type-1 induced cell-to-cell fusion and virus spread.
21898481 2012 Shedding of syndecan-1 from human hepatocytes alters very low density lipoprotein clearance.
21886795 2011 Modulation of syndecan-1 shedding after hemorrhagic shock and resuscitation.
21772125 2011 A high admission syndecan-1 level, a marker of endothelial glycocalyx degradation, is associated with inflammation, protein C depletion, fibrinolysis, and increased mortality in trauma patients.
21757697 2011 Heparanase-mediated loss of nuclear syndecan-1 enhances histone acetyltransferase (HAT) activity to promote expression of genes that drive an aggressive tumor phenotype.
21731601 2011 Specific syndecan-1 domains regulate mesenchymal tumor cell adhesion, motility and migration.
21630196 2011 CD138 expression in renal tumors and its usage in the differential diagnosis.
21623993 2011 Relevance of syndecan-1 in the trophoblastic BeWo cell syncytialization.
21463121 2011 Associations between regulators of extracellular matrix and hemostatic factors in hematologic neoplasias.
21454203 2011 CD138 expression helps distinguishing Waldenström's macroglobulinemia (WM) from splenic marginal zone lymphoma (SMZL).
21430259 2011 Syndecan-1 and syndecan-4 are independent indicators in breast carcinoma.
21414405 2011 Syndecan-1 and -4 differentially regulate oncogenic K-ras dependent cell invasion into collagen through ?2?1 integrin and MT1-MMP.
21334435 2011 Extracellular superoxide dismutase protects cardiovascular syndecan-1 from oxidative shedding.
21327984 2012 Enhanced syndecan-1 expression on neutrophils in patients with type 2 diabetes mellitus.
21320038 2011 Elevated serum level of circulating syndecan-1 (CD138) in active systemic lupus erythematosus.
21317913 2011 Altered expression patterns of syndecan-1 and -2 predict biochemical recurrence in prostate cancer.
21269460 2011 Initial characterization of the human central proteome.
21265098 2010 [Effect of high concentration of glucose on thickness of glycocalyx and expression of syndecan-1 and glypican-1 in cultured human renal glomerular endothelial cells].
21257720 2011 SST0001, a chemically modified heparin, inhibits myeloma growth and angiogenesis via disruption of the heparanase/syndecan-1 axis.
21148276 2011 Syndecan-1 and syndecan-2 play key roles in herpes simplex virus type-1 infection.
20971705 2010 Syndecan-1 couples the insulin-like growth factor-1 receptor to inside-out integrin activation.
20927321 2010 Syndecan-1-dependent suppression of PDK1/Akt/bad signaling by docosahexaenoic acid induces apoptosis in prostate cancer.
20736897 2010 Significance of intragraft CD138+ lymphocytes and p-S6RP in pediatric kidney transplant biopsies.
20683626 2013 Negative correlation between serum syndecan-1 and apolipoprotein A1 in patients with type 2 diabetes mellitus.
20598296 2010 Syndecan- and integrin-binding peptides synergistically accelerate cell adhesion.
20477813 2010 The prognostic value of intraepithelial and stromal CD3-, CD117- and CD138-positive cells in non-small cell lung carcinoma.
20471559 2010 Immunohistochemical study of syndecan-1 down-regulation and the expression of P35 protein in oral lichen planus: a clinicopathologic correlation with hepatitis C infection in the Egyptian population.
20430722 2009 Expression of syndecan-1 and cathepsins D and K in advanced esophageal squamous cell carcinoma.
20398359 2010 The expression of syndecan-1, syndecan-4 and decorin in healthy human breast tissue during the menstrual cycle.
20361982 2010 The Tiam1 PDZ domain couples to Syndecan1 and promotes cell-matrix adhesion.
20307537 2010 Bone marrow stromal cell interaction reduces syndecan-1 expression and induces kinomic changes in myeloma cells.
20237901 2010 Laminin-derived peptide AG73 regulates migration, invasion, and protease activity of human oral squamous cell carcinoma cells through syndecan-1 and beta1 integrin.
20204274 2010 Clinical significance of syndecan-1 and versican expression in human epithelial ovarian cancer.
20200931 2010 Tumor-derived syndecan-1 mediates distal cross-talk with bone that enhances osteoclastogenesis.
20193112 2010 Expression and clinical significance of syndecan-1 mRNA and HPA-1 mRNA in colorectal cancer detected with real-time fluorescent quantitative polymerase chain reaction.
20097882 2010 Heparanase-enhanced shedding of syndecan-1 by myeloma cells promotes endothelial invasion and angiogenesis.
20083849 2009 Syndecan signaling: when, where and why?
20081059 2010 Circulating human B and plasma cells. Age-associated changes in counts and detailed characterization of circulating normal CD138- and CD138+ plasma cells.
20036233 2010 Sdc1 negatively modulates carcinoma cell motility and invasion.
20013319 2010 Soluble CD138 serum levels are not associated with other poor prognostic markers in patients with B-chronic lymphocytic leukaemia.
20008145 2010 Enoxaparin improves the course of dextran sodium sulfate-induced colitis in syndecan-1-deficient mice.
19875451 2010 A disintegrin and metalloproteinase 17 (ADAM17) mediates inflammation-induced shedding of syndecan-1 and -4 by lung epithelial cells.
19866343 CD40-activated B cells from patients with systemic lupus erythematosus can be modulated by therapeutic immunoglobulins in vitro.
19860843 2010 Role of syndecan-1 (CD138) in cell survival of human urothelial carcinoma.
19822079 Expression of basic fibroblast growth factor, its receptors and syndecans in bladder cancer.
19802384 2009 Syndecan-1 and FGF-2, but not FGF receptor-1, share a common transport route and co-localize with heparanase in the nuclei of mesenchymal tumor cells.
19735958 2009 Insulin increases shedding of syndecan-1 in the serum of patients with type 2 diabetes mellitus.
19696445 2009 Heparan sulfate proteoglycan modulation of Wnt5A signal transduction in metastatic melanoma cells.
19632304 2009 Syndecan-1 and syndecan-4 are involved in RANTES/CCL5-induced migration and invasion of human hepatoma cells.
19596856 2009 Syndecan-1 is required for robust growth, vascularization, and metastasis of myeloma tumors in vivo.
19581738 2009 Syndecan-1 and tenascin expression in cystic tumors of the pancreas.
19473447 2009 Reduction of syndecan-1 expression during lip carcinogenesis.
19456850 2009 APRIL and TACI interact with syndecan-1 on the surface of multiple myeloma cells to form an essential survival loop.
19450993 The expression of syndecan-1 and -2 is associated with Gleason score and epithelial-mesenchymal transition markers, E-cadherin and beta-catenin, in prostate cancer.
19420730 2009 Expression of syndecan-1 and E-cadherin is inversely correlated with poor patient's prognosis and recurrent status of extrahepatic bile duct carcinoma.
19351365 2009 Comparative expression of syndecan-1 and Ki-67 in peripheral and desmoplastic ameloblastomas and ameloblastic carcinoma.
19305494 2009 Heparanase regulates levels of syndecan-1 in the nucleus.
19255147 2009 Syndecan-1 regulates alphavbeta3 and alphavbeta5 integrin activation during angiogenesis and is blocked by synstatin, a novel peptide inhibitor.
19251947 2009 Shed syndecan-1 restricts neutrophil elastase from alpha1-antitrypsin in neutrophilic airway inflammation.
19228696 2009 Tyrosine dephosphorylation of the syndecan-1 PDZ binding domain regulates syntenin-1 recruitment.
19126645 2009 Differential roles for membrane-bound and soluble syndecan-1 (CD138) in breast cancer progression.
19107206 2008 Distinct genetic loci control plasma HIV-RNA and cellular HIV-DNA levels in HIV-1 infection: the ANRS Genome Wide Association 01 study.
19073610 2009 Oxidative stress alters syndecan-1 distribution in lungs with pulmonary fibrosis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19029267 2008 Syndecan-1 plasma levels during coronary artery bypass surgery with and without cardiopulmonary bypass.
19020713 2008 Inhibition of syndecan-1 expression and function in oral cancer cells.
19010933 2008 Membrane type 1 matrix metalloproteinase-mediated stromal syndecan-1 shedding stimulates breast carcinoma cell proliferation.
18997617 2009 Expression of Galectin-3, CD138, p16INK4a, and TTF-1 in mucinous bronchioloalveolar adenocarcinoma after Hodgkin lymphoma.
18957427 2008 Syndecan-1 ectodomain shedding is regulated by the small GTPase Rab5.
18694404 2009 Syndecan 1 (CD138) serum levels: a novel biomarker in predicting liver fibrosis stage in patients with hepatitis C.
18657535 2008 Syndecan-1 supports integrin alpha2beta1-mediated adhesion to collagen.
18542065 2008 Prognostic impact of syndecan-1 expression in invasive ductal breast carcinomas.
18450755 2008 In vivo and in vitro regulation of syndecan 1 in prostate cells by n-3 polyunsaturated fatty acids.
18450428 2008 In vitro reconstructed normal human epidermis expresses differentiation-related proteoglycans.
18413760 2008 Peroxisome proliferator-activated receptor gamma-mediated up-regulation of syndecan-1 by n-3 fatty acids promotes apoptosis of human breast cancer cells.
18386024 2008 The expression of syndecan-1 in psoriatic epidermis.
18378436 2008 Adhesion and protease activity in cell lines from human salivary gland tumors are regulated by the laminin-derived peptide AG73, syndecan-1 and beta1 integrin.
18190591 2009 Soluble syndecan-1 (sCD138) as a prognostic factor independent of mutation status in patients with chronic lymphocytic leukemia.
18093920 2007 Transmembrane domains of the syndecan family of growth factor coreceptors display a hierarchy of homotypic and heterotypic interactions.
18064305 2008 Heparan sulfate and syndecan-1 are essential in maintaining murine and human intestinal epithelial barrier function.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18006945 2007 Evaluation of the association with cervical cancer of polymorphisms in syndecan-1, a heparan sulfate proteoglycan involved with viral cell entry.
17625591 2008 Ectopic expression of syndecan-1 in basal epidermis affects keratinocyte proliferation and wound re-epithelialization.
17579341 2008 Syndecan-1 interaction with the LG4/5 domain in laminin-332 is essential for keratinocyte migration.
17455248 2007 Syndecan-1, a key regulator of cell viability in endometrial cancer.
17431390 2007 E-cadherin adhesion molecule and syndecan-1 expression in various thyroid pathologies.
17413980 2007 Expression of extracellular matrix proteins in ovarian serous tumors.
17339423 2007 Heparanase influences expression and shedding of syndecan-1, and its expression by the bone marrow environment is a bad prognostic factor in multiple myeloma.
17314405 2007 The short arm of laminin gamma2 chain of laminin-5 (laminin-332) binds syndecan-1 and regulates cellular adhesion and migration by suppressing phosphorylation of integrin beta4 chain.
17149710 2007 Mechanical strain induces a persistent upregulation of syndecan-1 expression in smooth muscle cells.
16982797 2006 Heparanase deglycanation of syndecan-1 is required for binding of the epithelial-restricted prosecretory mitogen lacritin.
16945147 2006 Syndecan-1 mediates internalization of apoE-VLDL through a low density lipoprotein receptor-related protein (LRP)-independent, non-clathrin-mediated pathway.
16884912 2006 Synergistic effect of tumor necrosis factor-alpha and interferon-gamma on enterocyte shedding of syndecan-1 and associated decreases in internalization of Listeria monocytogenes and Staphylococcus aureus.
16857657 2006 Expression of Syndecan-1 in histologically normal breast tissue from postmenopausal women with breast cancer according to mammographic density.
16840194 2006 Serum levels of syndecan-1 in B-cell chronic lymphocytic leukemia: correlation with the extent of angiogenesis and disease-progression risk in early disease.
16778379 2006 Prognostic evaluation of nodal diffuse large B cell lymphoma by immunohistochemical profiles with emphasis on CD138 expression as a poor prognostic factor.
16773719 2006 Roles of syndecan-1, bcl6 and p53 in diagnosis and prognostication of immunoproliferative small intestinal disease.
16720645 2006 Syndecan-1 regulates alphavbeta5 integrin activity in B82L fibroblasts.
16636895 2006 Syndecan-1 and syndecan-4 are overexpressed in an estrogen receptor-negative, highly proliferative breast carcinoma subtype.
16341674 2005 Transcriptome analysis of human gastric cancer.
16286510 2005 Growth factor-induced shedding of syndecan-1 confers glypican-1 dependence on mitogenic responses of cancer cells.
16247452 2006 Syndecan-1 expression by stromal fibroblasts promotes breast carcinoma growth in vivo and stimulates tumor angiogenesis.
16132527 2006 Expression of syndecans, a heparan sulfate proteoglycan, in malignant gliomas: participation of nuclear factor-kappaB in upregulation of syndecan-1 expression.
16020957 2005 Epithelial syndecan-1 expression is associated with stage and grade in colorectal cancer.
16007225 2005 Adhesion signaling by a novel mitotic substrate of src kinases.
15902740 2005 Syndecan-1 and E-cadherin expression in differentiated type of early gastric cancer.
15886501 2005 Syndecan-1 expression--a novel prognostic marker in pancreatic cancer.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15770719 2005 Clinicopathological significance of expression of paxillin, syndecan-1 and EMMPRIN in hepatocellular carcinoma.
15743035 2004 Clinicopathological study of the expression of syndecan-1 in invasive breast carcinomas. correlation with extracellular matrix components.
15728209 2005 Syndecan-1 is involved in osteoprotegerin-induced chemotaxis in human peripheral blood monocytes.
15648090 2005 Porphyromonas gingivalis lipopolysaccharide induces shedding of syndecan-1 expressed by gingival epithelial cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15479743 2004 The syndecan-1 ectodomain regulates alphavbeta3 integrin activity in human mammary carcinoma cells.
15459490 2004 Prognostic value of syndecan-1 expression in breast cancer.
15383330 2004 Syndecan-1 ectodomain regulates matrix-dependent signaling in human breast carcinoma cells.
15297422 2004 Distribution and clinical significance of heparan sulfate proteoglycans in ovarian cancer.
15292202 2004 Heparanase uptake is mediated by cell membrane heparan sulfate proteoglycans.
15177497 2004 Shift of syndecan-1 expression from epithelial to stromal cells during progression of solid tumours.
15126321 2004 Syndecan-1 up-regulated by ephrinB2/EphB4 plays dual roles in inflammatory angiogenesis.
14972511 2004 Syndecan-1 expression in locally invasive and metastatic prostate cancer.
14744776 2004 Induction of syndecan-1 expression in stromal fibroblasts promotes proliferation of human breast cancer cells.
14701864 2004 ADAMTS4 (aggrecanase-1) activation on the cell surface involves C-terminal cleavage by glycosylphosphatidyl inositol-anchored membrane type 4-matrix metalloproteinase and binding of the activated proteinase to chondroitin sulfate and heparan sulfate on syndecan-1.
14645569 2003 Different heparan sulfate proteoglycans serve as cellular receptors for human papillomaviruses.
14637022 2003 Interaction of RANTES with syndecan-1 and syndecan-4 expressed by human primary macrophages.
14630925 2004 Heparanase degrades syndecan-1 and perlecan heparan sulfate: functional implications for tumor cell invasion.
14521955 2003 Proteolytic processing of IGFBP-related protein-1 (TAF/angiomodulin/mac25) modulates its biological activity.
12975379 2003 Syndecan-1 transmembrane and extracellular domains have unique and distinct roles in cell spreading.
12947106 2003 Normal human keratinocytes bind to the alpha3LG4/5 domain of unprocessed laminin-5 through the receptor syndecan-1.
12920224 2003 Induced expression of syndecan-1 in the stroma of head and neck squamous cell carcinoma.
12904296 2003 Cleavage of syndecan-1 by membrane type matrix metalloproteinase-1 stimulates cell migration.
12902511 2003 Plasminogen activator inhibitor-1 supports IL-8-mediated neutrophil transendothelial migration by inhibition of the constitutive shedding of endothelial IL-8/heparan sulfate/syndecan-1 complexes.
12885232 2003 Structural and dynamic properties of the HIV-1 tat transduction domain in the free and heparin-bound states.
12879463 2003 High syndecan-1 expression in breast carcinoma is related to an aggressive phenotype and to poorer prognosis.
12824007 2003 Regulation of epithelial syndecan-1 expression by inflammatory cytokines.
12749851 2003 Syndecan-1-mediated cell spreading requires signaling by alphavbeta3 integrins in human breast carcinoma cells.
12660231 2003 Syndecan-1 expression is regulated in an isoform-specific manner by the farnesoid-X receptor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12464176 2002 Matrilysin shedding of syndecan-1 regulates chemokine mobilization and transepithelial efflux of neutrophils in acute lung injury.
12144130 CD138.
12091355 2002 Soluble syndecan-1 promotes growth of myeloma tumors in vivo.
11877089 2001 [Relative study of soluble syndecan-1 and prognosis of patients with multiple myeloma].
11830493 2002 Cell surface proteoglycan syndecan-1 mediates hepatocyte growth factor binding and promotes Met signaling in multiple myeloma.
11567105 2001 Heparin binding by the HIV-1 tat protein transduction domain.
11179419 2001 Characterization of syntenin, a syndecan-binding PDZ protein, as a component of cell adhesion sites and microfilaments.
11024024 2001 Internalization of HIV-1 tat requires cell surface heparan sulfate proteoglycans.
10506830 1999 Transcriptional regulation of Syndecan-1 expression by growth factors.
10497173 1999 Multiple interactions of HIV-I Tat protein with size-defined heparin oligosaccharides.
9857223 1998 Immunohistochemical expression of syndecan-1 in human endometrial cancer cells.
9792716 1998 Multiple heparan sulfate chains are required for optimal syndecan-1 function.
9660868 1998 Human CASK/LIN-2 binds syndecan-2 and protein 4.1 and localizes to the basolateral membrane of epithelial cells.
9566955 1998 Developmentally regulated expression and localization of fibroblast growth factor receptors in the human muscle.
9565572 1998 Syndecans, heparan sulfate proteoglycans, maintain the proteolytic balance of acute wound fluids.
9548182 Expression of syndecan-1 in human placenta and decidua.
9342064 1997 HIV-1 Tat protein exits from cells via a leaderless secretory pathway and binds to extracellular matrix-associated heparan sulfate proteoglycans through its basic region.
9294130 1997 The syndecan family of proteoglycans. Novel receptors mediating internalization of atherogenic lipoproteins in vitro.
9169435 1997 Regulated shedding of syndecan-1 and -4 ectodomains by thrombin and growth factor receptor activation.
9111037 1997 Interaction of HIV-1 Tat protein with heparin. Role of the backbone structure, sulfation, and size.
9089390 1997 Expression of syndecan-1 and -3 during embryogenesis of the central nervous system in relation to binding with midkine.
9050911 1997 The mapping and visual ordering of the human syndecan-1 and N-myc genes near the telomeric region of chromosome 2p.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8570206 1996 HIV-tat protein is a heparin-binding angiogenic growth factor.
8163535 1994 Core protein structure and sequence determine the site and presence of heparan sulfate and chondroitin sulfate on syndecan-1.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8118875 1994 Interleukin-6 regulates expression of the syndecan-1 proteoglycan on B lymphoid cells.
7959737 1994 Mapping of the syndecan genes in the mouse: linkage with members of the myc gene family.
7690138 1993 The Tat protein of human immunodeficiency virus type 1, a growth factor for AIDS Kaposi sarcoma and cytokine-activated vascular cells, induces adhesion of the same cell types by using integrin receptors recognizing the RGD amino acid sequence.
7592967 1995 Repetitive Ser-Gly sequences enhance heparan sulfate assembly in proteoglycans.
7592855 1995 Self-association of N-syndecan (syndecan-3) core protein is mediated by a novel structural motif in the transmembrane domain and ectodomain flanking region.
2519615 1989 B lymphocytes express and lose syndecan at specific stages of differentiation.
2324102 1990 Sequence of human syndecan indicates a novel gene family of integral membrane proteoglycans.
2173154 1990 Localization of gene for human syndecan, an integral membrane proteoglycan and a matrix receptor, to chromosome 2.
1664683 1991 The molecular biology of heparan sulfate fibroblast growth factor receptors.
1644217 1992 Transient expression of syndecan in mesenchymal cell aggregates of the embryonic kidney.
1442271 1992 Structural and functional diversity of the heparan sulfate proteoglycans.
1339431 1992 Differential expression of cell surface heparan sulfate proteoglycans in human mammary epithelial cells and lung fibroblasts.