Property Summary

NCBI Gene PubMed Count 17
PubMed Score 11.75
PubTator Score 9.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical adenoma -1.173 1.3e-03
adrenocortical carcinoma -1.986 7.6e-15
adult high grade glioma 1.100 8.5e-03
Astrocytoma, Pilocytic 1.700 3.0e-06
Atopic dermatitis -1.100 1.5e-03
atypical teratoid / rhabdoid tumor 2.600 4.2e-04
Breast cancer 1.400 1.2e-03
cystic fibrosis -2.089 3.6e-06
glioblastoma 1.300 3.5e-03
invasive ductal carcinoma 1.500 3.1e-02
medulloblastoma 1.100 2.2e-04
medulloblastoma, large-cell 1.600 9.9e-06
non-small cell lung cancer 1.227 1.2e-08
osteosarcoma 2.690 1.9e-03
ovarian cancer 1.400 4.4e-10
pancreatic cancer 1.200 5.2e-04
posterior fossa group A ependymoma 1.200 2.8e-04
primitive neuroectodermal tumor 2.200 1.1e-03
psoriasis -1.700 3.6e-47

Gene RIF (8)

AA Sequence

MGSGRVPGLCLLVLLVHARAAQYSKAAQDVDECVEGTDNCHIDAICQNTPRSYKCICKSGYTGDGKHCKD      1 - 70
VDECEREDNAGCVHDCVNIPGNYRCTCYDGFHLAHDGHNCLDVDECAEGNGGCQQSCVNMMGSYECHCRE     71 - 140
GFFLSDNQHTCIQRPEEGMNCMNKNHGCAHICRETPKGGIACECRPGFELTKNQRDCKLTCNYGNGGCQH    141 - 210
TCDDTEQGPRCGCHIKFVLHTDGKTCIETCAVNNGGCDSKCHDAATGVHCTCPVGFMLQPDRKTCKDIDE    211 - 280
CRLNNGGCDHICRNTVGSFECSCKKGYKLLINERNCQDIDECSFDRTCDHICVNTPGSFQCLCHRGYLLY    281 - 350
GITHCGDVDECSINRGGCRFGCINTPGSYQCTCPAGQGRLHWNGKDCTEPLKCQGSPGASKAMLSCNRSG    351 - 420
KKDTCALTCPSRARFLPESENGFTVSCGTPSPRAAPARAGHNGNSTNSNHCHEAAVLSIKQRASFKIKDA    421 - 490
KCRLHLRNKGKTEEAGRITGPGGAPCSECQVTFIHLKCDSSRKGKGRRARTPPGKEVTRLTLELEAEVRA    491 - 560
EETTASCGLPCLRQRMERRLKGSLKMLRKSINQDRFLLRLAGLDYELAHKPGLVAGERAEPMESCRPGQH    561 - 630
RAGTKCVSCPQGTYYHGQTEQCVPCPAGTFQEREGQLSCDLCPGSDAHGPLGATNVTTCAGQCPPGQHSV    631 - 700
DGFKPCQPCPRGTYQPEAGRTLCFPCGGGLTTKHEGAISFQDCDTKVQCSPGHYYNTSIHRCIRCAMGSY    701 - 770
QPDFRQNFCSRCPGNTSTDFDGSTSVAQCKNRQCGGELGEFTGYIESPNYPGNYPAGVECIWNINPPPKR    771 - 840
KILIVVPEIFLPSEDECGDVLVMRKNSSPSSITTYETCQTYERPIAFTARSRKLWINFKTSEANSARGFQ    841 - 910
IPYVTYDEDYEQLVEDIVRDGRLYASENHQEILKDKKLIKAFFEVLAHPQNYFKYTEKHKEMLPKSFIKL    911 - 980
LRSKVSSFLRPYK                                                             981 - 993
//

Text Mined References (18)

PMID Year Title