Property Summary

NCBI Gene PubMed Count 15
PubMed Score 11.52
PubTator Score 9.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
osteosarcoma 2.690 1.9e-03
cystic fibrosis -2.089 3.6e-06
atypical teratoid / rhabdoid tumor 2.600 4.2e-04
glioblastoma 1.300 3.5e-03
medulloblastoma 1.100 2.2e-04
medulloblastoma, large-cell 1.600 9.9e-06
primitive neuroectodermal tumor 2.200 1.1e-03
Atopic dermatitis -1.100 1.5e-03
adrenocortical adenoma -1.173 1.3e-03
adrenocortical carcinoma -1.986 7.6e-15
non-small cell lung cancer 1.227 1.2e-08
pancreatic cancer 1.200 5.2e-04
adult high grade glioma 1.100 8.5e-03
pilocytic astrocytoma 1.700 2.1e-06
posterior fossa group B ependymoma 1.300 1.5e-05
Breast cancer 1.400 1.2e-03
invasive ductal carcinoma 1.500 3.1e-02
ovarian cancer 1.400 4.4e-10
psoriasis -1.700 3.6e-47

Gene RIF (6)

PMID Text
24390364 Results indicated that SCUBE3 might be involved in regulating the epithelial-mesenchymal transition (EMT) and malignant progression in NSCLC.
24084593 Scube3 facilitates both TGFbeta and Hh signalling within an overall role of facillating inflammatory angiogenesis.
23420440 results show that SCUBE3 knockdown was associated with lower vascular permeability in the tumor and effectively inhibited the metastatic potential of non-small-cell lung carcinoma
21441952 in lung cancer cells, SCUBE3 could serve as an endogenous autocrine and paracrine ligand of TGF-beta type II receptor, which could regulate TGF-beta receptor signaling and modulate EMT and cancer progression
20546612 Observational study of gene-disease association. (HuGE Navigator)
15234972 may act locally and/or distantly through a proteolytic mechanism, and may play an important role in bone cell biology

AA Sequence

MGSGRVPGLCLLVLLVHARAAQYSKAAQDVDECVEGTDNCHIDAICQNTPRSYKCICKSGYTGDGKHCKD      1 - 70
VDECEREDNAGCVHDCVNIPGNYRCTCYDGFHLAHDGHNCLDVDECAEGNGGCQQSCVNMMGSYECHCRE     71 - 140
GFFLSDNQHTCIQRPEEGMNCMNKNHGCAHICRETPKGGIACECRPGFELTKNQRDCKLTCNYGNGGCQH    141 - 210
TCDDTEQGPRCGCHIKFVLHTDGKTCIETCAVNNGGCDSKCHDAATGVHCTCPVGFMLQPDRKTCKDIDE    211 - 280
CRLNNGGCDHICRNTVGSFECSCKKGYKLLINERNCQDIDECSFDRTCDHICVNTPGSFQCLCHRGYLLY    281 - 350
GITHCGDVDECSINRGGCRFGCINTPGSYQCTCPAGQGRLHWNGKDCTEPLKCQGSPGASKAMLSCNRSG    351 - 420
KKDTCALTCPSRARFLPESENGFTVSCGTPSPRAAPARAGHNGNSTNSNHCHEAAVLSIKQRASFKIKDA    421 - 490
KCRLHLRNKGKTEEAGRITGPGGAPCSECQVTFIHLKCDSSRKGKGRRARTPPGKEVTRLTLELEAEVRA    491 - 560
EETTASCGLPCLRQRMERRLKGSLKMLRKSINQDRFLLRLAGLDYELAHKPGLVAGERAEPMESCRPGQH    561 - 630
RAGTKCVSCPQGTYYHGQTEQCVPCPAGTFQEREGQLSCDLCPGSDAHGPLGATNVTTCAGQCPPGQHSV    631 - 700
DGFKPCQPCPRGTYQPEAGRTLCFPCGGGLTTKHEGAISFQDCDTKVQCSPGHYYNTSIHRCIRCAMGSY    701 - 770
QPDFRQNFCSRCPGNTSTDFDGSTSVAQCKNRQCGGELGEFTGYIESPNYPGNYPAGVECIWNINPPPKR    771 - 840
KILIVVPEIFLPSEDECGDVLVMRKNSSPSSITTYETCQTYERPIAFTARSRKLWINFKTSEANSARGFQ    841 - 910
IPYVTYDEDYEQLVEDIVRDGRLYASENHQEILKDKKLIKAFFEVLAHPQNYFKYTEKHKEMLPKSFIKL    911 - 980
LRSKVSSFLRPYK                                                             981 - 993
//

Text Mined References (16)

PMID Year Title
24849422 2014 [Role of SCUBE3 in promoting osteosarcoma cell growth and its association with prognosis].
24390364 2013 SCUBE3 overexpression predicts poor prognosis in non-small cell lung cancer.
24084593 2013 Scube regulates synovial angiogenesis-related signaling.
24084050 2013 The role of Vitamin D level and related single nucleotide polymorphisms in Crohn's disease.
23420440 2013 SCUBE3 regulation of early lung cancer angiogenesis and metastatic progression.
21441952 2011 SCUBE3 is an endogenous TGF-? receptor ligand and regulates the epithelial-mesenchymal transition in lung cancer.
21132003 2011 Genome-wide methylation analysis identifies epigenetically inactivated candidate tumour suppressor genes in renal cell carcinoma.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
18391951 2008 Many sequence variants affecting diversity of adult human height.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15234972 2004 A novel secreted, cell-surface glycoprotein containing multiple epidermal growth factor-like repeats and one CUB domain is highly expressed in primary osteoblasts and bones.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12270931 2002 Identification of a novel family of cell-surface proteins expressed in human vascular endothelium.