Property Summary

NCBI Gene PubMed Count 100
PubMed Score 131.14
PubTator Score 132.38

Knowledge Summary

Patent (3,613)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8

Expression

  Differential Expression (7)

Disease log2 FC p
cystic fibrosis -1.400 1.5e-04
interstitial cystitis -1.900 2.7e-04
lung adenocarcinoma -1.200 3.3e-07
lung carcinoma -1.500 6.2e-19
nasopharyngeal carcinoma 1.900 3.6e-03
non-small cell lung cancer -1.531 1.5e-08
primary Sjogren syndrome -1.500 5.0e-03

Protein-protein Interaction (1)

Gene RIF (76)

AA Sequence

MAPGEKIKAKIKKNLPVTGPQAPTIKELMRWYCLNTNTHGCRRIVVSRGRLRRLLWIGFTLTAVALILWQ      1 - 70
CALLVFSFYTVSVSIKVHFRKLDFPAVTICNINPYKYSTVRHLLADLEQETREALKSLYGFPESRKRREA     71 - 140
ESWNSVSEGKQPRFSHRIPLLIFDQDEKGKARDFFTGRKRKVGGSIIHKASNVMHIESKQVVGFQLCSND    141 - 210
TSDCATYTFSSGINAIQEWYKLHYMNIMAQVPLEKKINMSYSAEELLVTCFFDGVSCDARNFTLFHHPMH    211 - 280
GNCYTFNNRENETILSTSMGGSEYGLQVILYINEEEYNPFLVSSTGAKVIIHRQDEYPFVEDVGTEIETA    281 - 350
MVTSIGMHLTESFKLSEPYSQCTEDGSDVPIRNIYNAAYSLQICLHSCFQTKMVEKCGCAQYSQPLPPAA    351 - 420
NYCNYQQHPNWMYCYYQLHRAFVQEELGCQSVCKEACSFKEWTLTTSLAQWPSVVSEKWLLPVLTWDQGR    421 - 490
QVNKKLNKTDLAKLLIFYKDLNQRSIMESPANSIEMLLSNFGGQLGLWMSCSVVCVIEIIEVFFIDFFSI    491 - 560
IARRQWQKAKEWWAWKQAPPCPEAPRSPQGQDNPALDIDDDLPTFNSALHLPPALGTQVPGTPPPKYNTL    561 - 630
RLERAFSNQLTDTQMLDEL                                                       631 - 649
//

Text Mined References (103)

PMID Year Title