Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.67
PubTator Score 2.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
pancreatic cancer -1.100 1.9e-02
astrocytic glioma -1.100 3.3e-02
osteosarcoma 1.825 4.4e-03
atypical teratoid / rhabdoid tumor -1.500 1.8e-03
tuberculosis -1.300 1.3e-04
Common variable immunodeficiency -1.513 7.2e-03
lung cancer -1.400 1.9e-02
sonic hedgehog group medulloblastoma -1.100 3.9e-02
pancreatic carcinoma -1.100 1.9e-02
spina bifida -1.506 3.1e-02
Pick disease -1.700 1.1e-05
progressive supranuclear palsy -1.500 1.4e-02
Breast cancer -1.600 4.0e-04
ovarian cancer -1.700 4.0e-05

Gene RIF (1)

PMID Text
18601738 the molecular evolutionary pattern of SCML1 in diverse primate species showed a strong signature of adaptive evolution which is caused by Darwinian positive selection

AA Sequence

MMSNSSSEIDVIKTRIPTYDEDDNTILYAYETKPEFVNKEPNIVSDASCNTEEQLKTVDDVLIHCQVIYD      1 - 70
ALQNLDKKIDVIRRKVSKIQRFHARSLWTNHKRYGYKKHSYRLVKKLKLQKMKKNEVYETFSYPESYSPT     71 - 140
LPVSRRENNSPSNLPRPSFCMEEYQRAELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLC    141 - 210
LGNPRADSIHNTYSTDHASAAPPSVTRSPVENDGYIEEGSITKHPSTWSVEAVVLFLKQTDPLALCPLVD    211 - 280
LFRSHEIDGKALLLLTSDVLLKHLGVKLGTAVKLCYYIDRLKQGKCFEN                         281 - 329
//

Text Mined References (9)

PMID Year Title
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18601738 2008 Adaptive evolution of SCML1 in primates, a gene involved in male reproduction.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9570953 1998 Characterization of SCML1, a new gene in Xp22, with homology to developmental polycomb genes.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.