Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.61
PubTator Score 3.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 2.900 4.8e-02
group 3 medulloblastoma 1.300 5.4e-03
intraductal papillary-mucinous neoplasm ... 1.400 4.9e-03
osteosarcoma -1.264 1.9e-03
ovarian cancer -1.100 4.8e-07
posterior fossa group B ependymoma 1.300 7.4e-05
primitive neuroectodermal tumor 1.100 1.9e-02
tuberculosis 1.800 1.3e-05

Gene RIF (2)

AA Sequence

MAAEIDFLREQNRRLNEDFRRYQMESFSKYSSVQKAVCQGEGDDTFENLVFDQSFLAPLVTEYDKHLGEL      1 - 70
NGQLKYYQKQVGEMKLQLENVIKENERLHSELKDAVEKKLEAFPLGTEVGTDIYADDETVRNLQEQLQLA     71 - 140
NQEKTQAVELWQTVSQELDRLHKLYQEHMTEAQIHVFESQKQKDQLFDFQQLTKQLHVTNENMEVTNQQF    141 - 210
LKTVTEQSVIIEQLRKKLRQAKLELRVAVAKVEELTNVTEDLQGQMKKKEKDVVSAHGREEASDRRLQQL    211 - 280
QSSIKQLEIRLCVTIQEANQLRTENTHLEKQTRELQAKCNELENERYEAIVRARNSMQLLEEANLQKSQA    281 - 350
LLEEKQKEEDIEKMKETVSRFVQDATIRTKKEVANTKKQCNIQISRLTEELSALQMECAEKQGQIERVIK    351 - 420
EKKAVEEELEKIYREGRGNESDYRKLEEMHQRFLVSERSKDDLQLRLTRAENRIKQLETDSSEEISRYQE    421 - 490
MIQKLQNVLESERENCGLVSEQRLKLQQENKQLRKETESLRKIALEAQKKAKVKISTMEHEFSIKERGFE    491 - 560
VQLREMEDSNRNSIVELRHLLATQQKAANRWKEETKKLTESAEIRINNLKSELSRQKLHTQELLSQLEMA    561 - 630
NEKVAENEKLILEHQEKANRLQRRLSQAEERAASASQQLSVITVQRRKAASLMNLENI                631 - 688
//

Text Mined References (14)

PMID Year Title