Property Summary

NCBI Gene PubMed Count 24
PubMed Score 33.63
PubTator Score 29.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
oligodendroglioma 1.100 4.3e-02
glioblastoma -3.200 3.5e-03
posterior fossa group A ependymoma -2.600 3.9e-05
atypical teratoid / rhabdoid tumor -5.900 2.4e-10
medulloblastoma -1.200 5.0e-03
medulloblastoma, large-cell -1.400 3.2e-05
primitive neuroectodermal tumor -1.200 1.0e-03
lung cancer 2.500 6.4e-06
colon cancer -1.100 3.4e-04
Parkinson's disease -1.300 1.3e-02
pediatric high grade glioma -2.000 1.9e-02
subependymal giant cell astrocytoma -2.694 1.9e-02
lung carcinoma 6.100 2.9e-78
Alzheimer's disease -1.500 1.5e-02
Pick disease -1.600 3.2e-04
progressive supranuclear palsy -1.300 1.4e-02
psoriasis -1.100 4.0e-18

 GO Function (1)

 GO Process (1)

Gene RIF (10)

PMID Text
24882622 HBXIP facilitates the proliferation of hepatoma cells by up-regulating SCG3 via E2F1 and miR-509-3p modulation.
22998035 SCG3 is essential in the process and targeting of neuropeptides and neurotrophins, its participation in the pathological progression of Alzheimer's disease may be suggested
22987761 SCG3 may be involved in apoptosis signal transduction as a caspase substrate.It may be a pivotal component of the neuroendocrine pathway & play an important role in neuronal communication & neurotransmitter release.
21796137 Our data suggest that genetic variations in the FTO, SCG3 and MTMR9 genes independently influence the risk of metabolic syndrome.
21046454 This short review deals with investigations in neuroendocrine tumors (NETs) with antibodies against defined epitopes of chromogranins (Cgs) A and B and secretogranins (Sgs) II and III.
20550951 SgIII was expressed in 41 of 47 neuroendocrine tumours. The expression of SgIII agreed well with that of CgA, CgB and SgII, with exceptions of phaeochromocytomas and parathyroid adenomas.
19150442 these data suggest that SgIII, DMT-1 and HNP-1 are implicated in cell-mediated LDL oxidation.
18448176 Secretogranins III assays failed to detect increased concentrations in any of the patients with neuroendocrine tumours.
17200173 Observational study of gene-disease association. (HuGE Navigator)
17200173 Genetic variations in the SCG3 gene may influence the risk of obesity through possible regulation of hypothalamic neuropeptide secretion.

AA Sequence

MGFLGTGTWILVLVLPIQAFPKPGGSQDKSLHNRELSAERPLNEQIAEAEEDKIKKTYPPENKPGQSNYS      1 - 70
FVDNLNLLKAITEKEKIEKERQSIRSSPLDNKLNVEDVDSTKNRKLIDDYDSTKSGLDHKFQDDPDGLHQ     71 - 140
LDGTPLTAEDIVHKIAARIYEENDRAVFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEE    141 - 210
DPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGENDETVSNTLTLTNGLERRTKTYSEDNFEELQYFPNF    211 - 280
YALLKSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDEMIALQTKNKLEKNATDN    281 - 350
ISKLFPAPSEKSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNPGGKTDEPKGKTEAYLEAIRKNIEWLK    351 - 420
KHDKKGNKEDYDLSKMRDFINKQADAYVEKGILDKEEAEAIKRIYSSL                          421 - 468
//

Text Mined References (27)

PMID Year Title
24882622 2014 The oncoprotein HBXIP up-regulates SCG3 through modulating E2F1 and miR-509-3p in hepatoma cells.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
22998035 2013 Secretory sorting receptors carboxypeptidase E and secretogranin III in amyloid ?-associated neural degeneration in Alzheimer's disease.
22987761 2012 Dysregulated expression of secretogranin III is involved in neurotoxin-induced dopaminergic neuron apoptosis.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21796137 2011 Association of variations in the FTO, SCG3 and MTMR9 genes with metabolic syndrome in a Japanese population.
21046454 2010 Immunohistochemical and biochemical studies with region-specific antibodies to chromogranins A and B and secretogranins II and III in neuroendocrine tumors.
20550951 2010 Secretogranin III in human neuroendocrine tumours: a comparative immunohistochemical study with chromogranins A and B and secretogranin II.
20159242 2010 Genome-wide association study of asthma identifies RAD50-IL13 and HLA-DR/DQ regions.
19150442 2009 LDL oxidation by THP-1 monocytes: implication of HNP-1, SgIII and DMT-1.
18448176 2008 Measurements of secretogranins II, III, V and proconvertases 1/3 and 2 in plasma from patients with neuroendocrine tumours.
17200173 2007 Functional single-nucleotide polymorphisms in the secretogranin III (SCG3) gene that form secretory granules with appetite-related neuropeptides are associated with obesity.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15125023 2004 Immunocytochemical localization of secretogranin III in the endocrine pancreas of male rats.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14630798 2004 Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.
14597614 2004 Secretogranin III binds to cholesterol in the secretory granule membrane as an adapter for chromogranin A.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12533531 2003 Immunocytochemical localization of secretogranin III in the anterior lobe of male rat pituitary glands.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388744 2002 Identification of a chromogranin A domain that mediates binding to secretogranin III and targeting to secretory granules in pituitary cells and pancreatic beta-cells.
12098761 2002 Cloning and characterization of a novel human secretory protein: secretogranin III.
8825061 1995 The granin family--its role in sorting and secretory granule formation.
7917832 1993 Primary structure of mouse secretogranin III and its absence from deficient mice.
2053134 1991 The granin (chromogranin/secretogranin) family.