Property Summary

NCBI Gene PubMed Count 41
PubMed Score 273.44
PubTator Score 128.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -1.100 5.6e-06
astrocytic glioma -1.800 3.0e-02
posterior fossa group B ependymoma -2.700 3.5e-04
sonic hedgehog group medulloblastoma -2.800 5.0e-04
medulloblastoma, large-cell -2.800 9.4e-03
adrenocortical adenoma -2.129 1.5e-02
intraductal papillary-mucinous carcinoma... -2.100 3.1e-02
lung cancer 4.800 8.5e-07
colon cancer -1.800 1.9e-03
aldosterone-producing adenoma -3.937 1.1e-02
lung carcinoma 6.700 1.6e-71
Alzheimer's disease -1.700 3.1e-02
Pick disease -1.800 2.1e-02
ductal carcinoma in situ 1.400 8.1e-03
ovarian cancer 3.000 5.7e-04
head and neck cancer and chronic obstruc... -1.200 3.7e-02
facioscapulohumeral dystrophy -1.700 8.0e-03

Gene RIF (20)

PMID Text
26378181 Differential Reovirus-Specific and Herpesvirus-Specific Activator Protein 1 Activation of Secretogranin II Leads to Altered Virus Secretion.
25307750 present data show that SgII is highly expressed in advanced prostate cancer and may contribute to the neuroendocrine differentiation by promoting the formation of secretory granules and the proliferation of PCa cells.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of secretogranin II (SCG2) in primary human brain microvascular endothelial cells
24556756 SN induces MUC5AC hypersecretion in a dose- and time-dependent manner; moreover, the MUC5AC over synthesis induced by SN is strongly associated with the enhanced binding of EGF to NRP1
23918206 Topical secretoneurin gene therapy accelerates diabetic wound healing by interaction between heparan-sulfate proteoglycans and basic FGF.
23423580 CgA, CgB, and secretoneurin are detectable in feces, and collagenous colitis patients express higher values than patients with inflammatory bowel disease and controls. In treatment, fecal secretoneurin decreased to control levels in collagenous colitis.
23081990 In vivo secretoneurin improves left ventricular function, inhibits remodeling, and reduces scar formation; in the infarct border zone, secretoneurin induces coronary angiogenesis.
22655045 Circulating Levels of SgII are Increased in Patients with chronic, stable heart failure.
22217803 Data describe the gene expression and protein production of SgII in normal adrenal glands and pheochromocytomas with the goal to examine the molecular mechanisms leading to the marked variations in the expression of EM66 in tumoral chromaffin tissue.
21803620 Manserin may serve as a marker of prostate cancer progression.
21046454 This short review deals with investigations in neuroendocrine tumors (NETs) with antibodies against defined epitopes of chromogranins (Cgs) A and B and secretogranins (Sgs) II and III.
20550951 More SgII immunoreactive cells were observed in phaeochromocytomas.
18721831 semiquantitative immunocytochemistry for secretogranin II in amyotrophic lateral sclerosis.
18549351 Suppression of Pdcd4 resulted in an increased release of CgA and Sg II and was accompanied by an up-regulation of intracellular PC1.
18448176 Increased concentrations of SgII, especially the N-terminal part of secretoneurin could be measured in plasma from patients with endocrine pancreatic tumours.
18239671 Results suggest that secretogranin II represents a key AP-1-regulated protein that counteracts nitric oxide toxicity and mediates neuronal differentiation of neuroblastoma cells.
17584765 a variant of Secretogranin II has a role in regulation by PHOX2 transcription factors and in hypertension
15572199 the high concentration of secretoneurin in the aqueous humor indicates a significant role of this peptide
12788858 secretogranin II-derived peptide EM66 generated in human tumoral chromaffin tissue; significant difference in EM66 concentrations between benign and malignant pheochromocytomas
11853870 Transendothelial migration of leukocytes and signalling mechanisms in response to the neuropeptide secretoneurin.

AA Sequence

MAEAKTHWLGAALSLIPLIFLISGAEAASFQRNQLLQKEPDLRLENVQKFPSPEMIRALEYIENLRQQAH      1 - 70
KEESSPDYNPYQGVSVPLQQKENGDESHLPERDSLSEEDWMRIILEALRQAENEPQSAPKENKPYALNSE     71 - 140
KNFPMDMSDDYETQQWPERKLKHMQFPPMYEENSRDNPFKRTNEIVEEQYTPQSLATLESVFQELGKLTG    141 - 210
PNNQKRERMDEEQKLYTDDEDDIYKANNIAYEDVVGGEDWNPVEEKIESQTQEEVRDSKENIEKNEQIND    211 - 280
EMKRSGQLGIQEEDLRKESKDQLSDDVSKVIAYLKRLVNAAGSGRLQNGQNGERATRLFEKPLDSQSIYQ    281 - 350
LIEISRNLQIPPEDLIEMLKTGEKPNGSVEPERELDLPVDLDDISEADLDHPDLFQNRMLSKSGYPKTPG    351 - 420
RAGTEALPDGLSVEDILNLLGMESAANQKTSYFPNPYNQEKVLPRLPYGAGRSRSNQLPKAAWIPHVENR    421 - 490
QMAYENLNDKDQELGEYLARMLVKYPEIINSNQVKRVPGQGSSEDDLQEEEQIEQAIKEHLNQGSSQETD    491 - 560
KLAPVSKRFPVGPPKNDDTPNRQYWDEDLLMKVLEYLNQEKAEKGREHIAKRAMENM                 561 - 617
//

Text Mined References (43)

PMID Year Title
26378181 2015 Differential Reovirus-Specific and Herpesvirus-Specific Activator Protein 1 Activation of Secretogranin II Leads to Altered Virus Secretion.
25416956 2014 A proteome-scale map of the human interactome network.
25307750 2014 Secretogranin II is overexpressed in advanced prostate cancer and promotes the neuroendocrine differentiation of prostate cancer cells.
24556756 2014 Secretoneurin induces airway mucus hypersecretion by enhancing the binding of EGF to NRP1.
23918206 2014 Topical secretoneurin gene therapy accelerates diabetic wound healing by interaction between heparan-sulfate proteoglycans and basic FGF.
23423580 2013 Increased fecal levels of chromogranin A, chromogranin B, and secretoneurin in collagenous colitis.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
23081990 2012 The angiogenic factor secretoneurin induces coronary angiogenesis in a model of myocardial infarction by stimulation of vascular endothelial growth factor signaling in endothelial cells.
22655045 2012 Secretogranin II; a protein increased in the myocardium and circulation in heart failure with cardioprotective properties.
22217803 2012 Differential expression and processing of secretogranin II in relation to the status of pheochromocytoma: implications for the production of the tumoral marker EM66.
22095909 2012 Serum ferritin levels are associated with a distinct phenotype of chronic hepatitis C poorly responding to pegylated interferon-alpha and ribavirin therapy.
21803620 2013 Manserin as a novel histochemical neuroendocrine marker in prostate cancer.
21046454 2010 Immunohistochemical and biochemical studies with region-specific antibodies to chromogranins A and B and secretogranins II and III in neuroendocrine tumors.
20550951 2010 Secretogranin III in human neuroendocrine tumours: a comparative immunohistochemical study with chromogranins A and B and secretogranin II.
20200953 2010 Genome-wide pleiotropy of osteoporosis-related phenotypes: the Framingham Study.
18721831 2009 Chromogranin peptides in amyotrophic lateral sclerosis.
18549351 2008 Knockdown of Pdcd4 results in induction of proprotein convertase 1/3 and potent secretion of chromogranin A and secretogranin II in a neuroendocrine cell line.
18448176 2008 Measurements of secretogranins II, III, V and proconvertases 1/3 and 2 in plasma from patients with neuroendocrine tumours.
18239671 2008 Secretogranin II: a key AP-1-regulated protein that mediates neuronal differentiation and protection from nitric oxide-induced apoptosis of neuroblastoma cells.
17584765 2007 An ancestral variant of Secretogranin II confers regulation by PHOX2 transcription factors and association with hypertension.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16807684 2006 Phosphoproteomic analysis of the human pituitary.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16101435 2005 Secretoneurin: a new player in angiogenesis and chemotaxis linking nerves, blood vessels and the immune system.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15572199 2004 Secretoneurin in the human aqueous humor and the absence of an effect of frequently used eye drops on the levels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14970115 2004 The neuropeptide secretoneurin acts as a direct angiogenic cytokine in vitro and in vivo.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12788858 2003 Identification of the secretogranin II-derived peptide EM66 in pheochromocytomas as a potential marker for discriminating benign versus malignant tumors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10678772 2000 Co-distribution patterns of chromogranin B-like immunoreactivity with chromogranin A and secretoneurin within the human brainstem.
10648883 2000 Isolation and characterization of the human secretogranin II gene promoter.
10619397 1999 Synergistic action of upstream elements and a promoter-proximal CRE is required for neuroendocrine cell-specific expression and second-messenger regulation of the gene encoding the human secretory protein secretogranin II.
9709974 1998 Identification of a novel secretogranin II-derived peptide (SgII(187-252)) in adult and fetal human adrenal glands using antibodies raised against the human recombinant peptide.
9654353 1998 Formation and sequence analysis of secretoneurin, a neuropeptide derived from secretogranin II, in mammalian, bird, reptile, amphibian and fish brains.
9473216 1998 Secretoneurin, a novel neuropeptide, is a potent chemoattractant for human eosinophils.
9100282 1997 Secretogranin II (SgII) distribution and processing studies in human normal and adenomatous anterior pituitaries using new polyclonal antibodies.
8825061 1995 The granin family--its role in sorting and secretory granule formation.
8617499 1996 Dispersion of chromogranin/secretogranin secretory protein family loci in mammalian genomes.
2745426 1989 The primary structure of human secretogranin II, a widespread tyrosine-sulfated secretory granule protein that exhibits low pH- and calcium-induced aggregation.
2053134 1991 The granin (chromogranin/secretogranin) family.
1425774 1992 Immunolocalization of secretogranin II, chromogranin A, and chromogranin B in differentiating human neuroblastoma cells.