Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.24
PubTator Score 0.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 1.5e-07
pilocytic astrocytoma 3086 1.4e-06
tuberculosis 1563 1.5e-06
glioblastoma 5572 5.5e-04
pancreatic cancer 2300 6.9e-04
pancreatic carcinoma 567 6.9e-04
Disease Target Count Z-score Confidence
Eye and adnexa disease 11 0.0 1.0

Expression

  Differential Expression (6)

Disease log2 FC p
pancreatic cancer 1.100 6.9e-04
osteosarcoma -2.061 1.5e-07
glioblastoma 1.200 5.5e-04
tuberculosis 1.400 1.5e-06
pilocytic astrocytoma 1.400 1.4e-06
pancreatic carcinoma 1.100 6.9e-04

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSASGVLSFTQQGWEQVLAKVKRAVVYLDAACAESLHWGCGSTRLLEAVGGPDCHLREFEPDAIGGGAKQ      1 - 70
PKAVFVLSCLLKGRTVEILRDIICRSHFQYCVVVTTVSHAVHLTANHVPAAAAAEMEGQQPVFEQLEEKL     71 - 140
CEWMGNMNYTAEVFHVPLLLAPVAPHFALTPAFASLFPLLPQDVHLLNSARPDKRKLGSLGDVDSTTLTP    141 - 210
ELLLQIRCLVSGLSSLCEHLGVREECFAVGSLSQVIAADLANYAPAKNRKKTAAGRASVVFVDRTLDLTG    211 - 280
AVGHHGDNLVEKIISALPQLPGHTNDVMVNMIALTALHTEEENYNVVAPGCLSQSSDTTAKALWEALLNT    281 - 350
KHKEAVMEVRRHLVEAASRENLPIKMSMGRVTPGQLMSYIQLFKNNLKALMNHCGLLQLGLATAQTLKHP    351 - 420
QTAKWDNFLAFERLLLQSIGESAMSVVLNQLLPMIKPVTQRTNEDYSPEELLILLIYIYSVTGELTVDKD    421 - 490
LCEAEEKVKKALAQVFCEESGLSPLLQKITDWDSSINLTFHKSKIAVDELFTSLRDIAGARSLLKQFKSV    491 - 560
YVPGNHTHQASYKPLLKQVVEEIFHPERPDSVDIEHMSSGLTDLLKTGFSMFMKVSRPHPSDYPLLILFV    561 - 630
VGGVTVSEVKMVKDLVASLKPGTQVIVLSTRLLKPLNIPELLFATDRLHPDLGF                    631 - 684
//

Text Mined References (8)

PMID Year Title
21685187 2011 Genome-wide association study of smoking behaviours in patients with COPD.
21269460 2011 Initial characterization of the human central proteome.
20395239 2010 Genome-wide association identifies ATOH7 as a major gene determining human optic disc size.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.