Property Summary

NCBI Gene PubMed Count 13
PubMed Score 23.19
PubTator Score 16.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
interstitial lung disease -1.700 2.6e-02
esophageal adenocarcinoma -4.400 2.5e-02
cutaneous lupus erythematosus -2.000 2.7e-03
psoriasis -1.600 6.5e-73
Atopic dermatitis -2.400 1.3e-04
non-small cell lung cancer -2.929 4.0e-20
intraductal papillary-mucinous neoplasm ... 3.300 1.8e-04
lung cancer -5.800 2.7e-07
pancreatic cancer 2.800 1.8e-05
cystic fibrosis 1.700 1.4e-04
lung adenocarcinoma -2.000 7.6e-10
nasopharyngeal carcinoma -2.500 1.4e-04
lung carcinoma -4.800 3.5e-45
spina bifida -2.259 4.4e-02

Gene RIF (3)

PMID Text
19211270 Sciellin, SPRR3, and periplakin transcripts were all upregulated (4.67-, 4.95-, 2.77-fold, respectively) by prolonged exposure to cyclic strain (24-72 h), but not at earlier time points.
15274303 Single nucleotide polymorphisms were detected in both matching tumor and normal esophageal tissues but no disease-associated mutations suggesting that SCEL is not a major factor in esophageal squamous cell carcinogenesis.
14632196 VDUP1 and sciellin were more highly expressed in keratinocytes undergoing differentiation and colocalization of the proteins could be demonstrated

AA Sequence

MSNVTLRKMSPTGNEMKSTTQGTTRKQQDFHEVNKRRTFLQDNSWIKKRPEEEKDENYGRVVLNRHNSHD      1 - 70
ALDRKVNERDVPKATISRYSSDDTLDRISDRNDAAKTYKANTLDNQLTNRSMSMFRSLEVTKLQPGGSLN     71 - 140
ANTSNTIASTSATTPVKKKRQSWFPPPPPGYNASSSTGTRRREPGVHPPIPPKPSSPVSSPNQLRQDNRQ    141 - 210
IHPPKPGVYTETNRSAERNIRSQDLDNIVKVATSLQRSDKGEELDNLIKMNKSLNRNQGLDSLFRANPKV    211 - 280
EEREKRAKSLESLIYMSTRTDKDGKGIQSLGSPIKVNQRTDKNEKGRQNLESVAKVNARMNKTSRRSEDL    281 - 350
DNATEVNPKGHENTTGKKDLDGLIKVDPETNKNITRGQSLDNLIKVTPEVKRSNQGSKDLNNFIKVYPGT    351 - 420
EKSTEGGQSLDSLIKVTPERNRTNQGNQDLENLIKVIPSANKSSEQGLDEHINVSPKAVKNTDGKQDLDK    421 - 490
LIKVNPEIFTNNQRNQDLANLIKVNPAVIRNNQSQDLDNLIKVKPSALRNTNRDQNLENLIEVNSHVSEN    491 - 560
KNGSSNTGAKQAGPQDTVVYTRTYVENSKSPKDGYQENISGKYIQTVYSTSDRSVIERDMCTYCRKPLGV    561 - 630
ETKMILDELQICCHSTCFKCEICKQPLENLQAGDSIWIYRQTIHCEPCYSKIMAKWIP                631 - 688
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21516116 2011 Next-generation sequencing to generate interactome datasets.
19211270 Biomechanical stress induces novel arterial intima-enriched genes: implications for vascular adaptation to stress.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15274303 Analysis of Sciellin (SCEL) as a candidate gene in esophageal squamous cell carcinoma.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14632196 2003 The expression of vitamin D-upregulated protein 1 in skin and its interaction with sciellin in cultured keratinocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11112355 2000 Gene characterization of sciellin (SCEL) and protein localization in vertebrate epithelia displaying barrier properties.
9813070 1998 cDNA cloning and characterization of sciellin, a LIM domain protein of the keratinocyte cornified envelope.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
1377656 1992 Characterization of sciellin, a precursor to the cornified envelope of human keratinocytes.