Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.27
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4971 5.5e-07
psoriasis 6514 2.8e-06
glioblastoma 5635 6.6e-05
osteosarcoma 7766 1.2e-03
astrocytoma 1113 1.7e-03
ependymoma 4559 7.5e-03

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.700 1.7e-03
atypical teratoid / rhabdoid tumor 1.400 5.5e-07
ependymoma 1.400 7.5e-03
glioblastoma 1.500 6.6e-05
osteosarcoma -1.540 1.2e-03
psoriasis -5.000 2.8e-06

Gene RIF (1)

AA Sequence

MSEKENNFPPLPKFIPVKPCFYQNFSDEIPVEHQVLVKRIYRLWMFYCATLGVNLIACLAWWIGGGSGTN      1 - 70
FGLAFVWLLLFTPCGYVCWFRPVYKAFRADSSFNFMAFFFIFGAQFVLTVIQAIGFSGWGACGWLSAIGF     71 - 140
FQYSPGAAVVMLLPAIMFSVSAAMMAIAIMKVHRIYRGAGGSFQKAQTEWNTGTWRNPPSREAQYNNFSG    141 - 210
NSLPEYPTVPSYPGSGQWP                                                       211 - 229
//

Text Mined References (9)

PMID Year Title