Property Summary

NCBI Gene PubMed Count 11
PubMed Score 300.35
PubTator Score 214.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
active ulcerative colitis -1.050 4.2e-02
adult high grade glioma -1.800 1.9e-03
astrocytic glioma -1.800 1.5e-02
Astrocytoma, Pilocytic -1.700 5.6e-05
atypical teratoid / rhabdoid tumor -2.000 9.6e-07
ependymoma -1.700 2.1e-02
glioblastoma -1.500 2.3e-06
lung adenocarcinoma -1.200 7.3e-16
malignant mesothelioma 2.400 1.0e-05
medulloblastoma -1.900 1.4e-06
medulloblastoma, large-cell -2.400 1.7e-04
nasopharyngeal carcinoma 1.600 8.4e-04
non-small cell lung cancer -1.754 3.9e-26
oligodendroglioma -1.500 4.0e-02
osteosarcoma -1.799 1.6e-04
ovarian cancer -1.200 3.7e-03
Pick disease -1.600 2.4e-02
pituitary cancer 1.900 1.9e-06
primitive neuroectodermal tumor -1.100 2.0e-02
progressive supranuclear palsy 1.200 2.4e-02
psoriasis -1.100 5.0e-03
tuberculosis 1.400 1.9e-04

Gene RIF (7)

AA Sequence

MVRGARQPQQPRSRLAPRLTGTVEKPPRKRRSRTEFALKEIMSSGGAEDDIPQGERKTVTDFCYLLDKSK      1 - 70
QLFNGLRDLPQYGQKQWQSYFGRTFDVYTKLWKFQQQHRQVLDNRYGLKRWQIGEIASKIGQLYYHYYLR     71 - 140
TSETSYLNEAFSFYSAIRQRSYYSQVNKEDRPELVVKKLRYYARFIVVCLLLNKMDVVKDLVKELSDEIE    141 - 210
DYTHRFNTEDQVEWNLVLQEVAAFIEADPVMVLNDDNTIVITSNRLAETGAPLLEQGMIVGQLSLADALI    211 - 280
IGNCNNQVKFSELTVDMFRMLQALEREPMNLASQMNKPGMQESADKPTRRENPHKYLLYKPTFSQLYTFL    281 - 350
AASFKELPANSVLLIYLSATGVFPTGRSDSEGPYDFGGVLTNSNRDIINGDAIHKRNQSHKEMHCLHPGD    351 - 420
LYPFTRKPLFIIVDSSNSVAYKNFTNLFGQPLVCLLSPTAYPKALQDQSQRGSLFTLFLNNPLMAFLFVS    421 - 490
GLSSMRRGLWEKCQEYLRKINRDIAQLLTHSRSIDQAFLQFFGDEFLRLLLTRFIFCSATMRMHKIFRET    491 - 560
RNYPESYPQLPRDETVENPHLQKHILELASILDVRNVFFENTIDDY                            561 - 606
//

Text Mined References (12)

PMID Year Title