Property Summary

NCBI Gene PubMed Count 16
PubMed Score 106.19
PubTator Score 34.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8491 1.2e-07
osteosarcoma 7933 1.6e-04
Waldenstrons macroglobulinemia 764 1.9e-02
Disease Target Count Z-score Confidence
Mental depression 58 0.0 1.0
Disease Target Count Z-score Confidence
Lateral sclerosis 13 3.019 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.239 1.9e-02
osteosarcoma -1.290 1.6e-04
ovarian cancer -1.800 1.2e-07

Protein-protein Interaction (3)

Gene RIF (3)

PMID Text
26056309 data suggest a model in which the 14-3-3 protein mediates SAC1 traffic from the ER through direct interaction with a sorting signal and COPII
18480408 Sac1 executes an essential household function in mammals that involves organization of both Golgi membranes and mitotic spindles
14527956 the enzymatic function of hSAC1 provides a switch for accessibility of the COPI interaction motif

AA Sequence

MATAAYEQLKLHITPEKFYVEACDDGADDVLTIDRVSTEVTLAVKKDVPPSAVTRPIFGILGTIHLVAGN      1 - 70
YLIVITKKIKVGEFFSHVVWKATDFDVLSYKKTMLHLTDIQLQDNKTFLAMLNHVLNVDGFYFSTTYDLT     71 - 140
HTLQRLSNTSPEFQEMSLLERADQRFVWNGHLLRELSAQPEVHRFALPVLHGFITMHSCSINGKYFDWIL    141 - 210
ISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIVHYNGSKASFVQTRGSIPVFWSQRPNLKYKPLPQISK    211 - 280
VANHMDGFQRHFDSQVIIYGKQVIINLINQKGSEKPLEQTFATMVSSLGSGMMRYIAFDFHKECKNMRWD    281 - 350
RLSILLDQVAEMQDELSYFLVDSAGQVVANQEGVFRSNCMDCLDRTNVIQSLLARRSLQAQLQRLGVLHV    351 - 420
GQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKTDFTRTGKRTHLGLIMDGWNSMIRYYKNNFSDGF    421 - 490
RQDSIDLFLGNYSVDELESHSPLSVPRDWKFLALPIIMVVAFSMCIICLLMAGDTWTETLAYVLFWGVAS    491 - 560
IGTFFIILYNGKDFVDAPRLVQKEKID                                               561 - 587
//

Text Mined References (23)

PMID Year Title
26056309 2015 Phosphoregulatory protein 14-3-3 facilitates SAC1 transport from the endoplasmic reticulum.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24209621 2013 A four-step cycle driven by PI(4)P hydrolysis directs sterol/PI(4)P exchange by the ER-Golgi tether OSBP.
22041458 2012 Pharmacogenomic study of side-effects for antidepressant treatment options in STAR*D.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18480408 2008 The Sac1 phosphoinositide phosphatase regulates Golgi membrane morphology and mitotic spindle organization in mammals.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14527956 2003 The human phosphatidylinositol phosphatase SAC1 interacts with the coatomer I complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11352561 2001 The LZTFL1 gene is a part of a transcriptional map covering 250 kb within the common eliminated region 1 (C3CER1) in 3p21.3.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10887188 2000 Functional characterization of a mammalian Sac1 and mutants exhibiting substrate-specific defects in phosphoinositide phosphatase activity.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.