Property Summary

NCBI Gene PubMed Count 72
PubMed Score 88.61
PubTator Score 109.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
active ulcerative colitis 1.038 2.1e-02
adult high grade glioma 1.500 3.6e-03
Atopic dermatitis 1.500 1.0e-04
atypical teratoid / rhabdoid tumor 1.400 1.7e-04
Breast cancer -1.300 7.0e-03
colon cancer 2.700 7.7e-03
ductal carcinoma in situ 2.300 5.6e-03
ependymoma 2.100 1.8e-07
esophageal adenocarcinoma -3.800 3.2e-02
glioblastoma 1.200 4.2e-03
lung adenocarcinoma 2.500 5.2e-05
malignant mesothelioma -1.300 2.6e-06
medulloblastoma, large-cell 1.100 2.3e-02
nasopharyngeal carcinoma -1.700 2.1e-02
non-small cell lung cancer 4.841 6.7e-17
ovarian cancer 3.100 1.0e-04
pancreatic cancer 2.000 7.9e-04
psoriasis 1.100 1.8e-06
spina bifida -2.475 4.9e-02
subependymal giant cell astrocytoma 1.098 1.5e-02
tuberculosis -1.100 1.9e-04

Gene RIF (48)

AA Sequence

MMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQ      1 - 70
VDFQEYAVFLALITVMCNDFFQGCPDRP                                               71 - 98
//

Text Mined References (75)

PMID Year Title