Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.59
PubTator Score 5.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia -1.100 1.4e-02
group 3 medulloblastoma 1.600 1.2e-03
lung adenocarcinoma -3.000 1.3e-13
lung carcinoma -5.400 6.5e-29
medulloblastoma, large-cell 1.600 2.9e-05
non-small cell lung cancer -2.160 5.6e-15
osteosarcoma -2.265 4.9e-08
primitive neuroectodermal tumor 1.400 5.2e-03

Gene RIF (6)

AA Sequence

MEGPSLRGPALRLAGLPTQQDCNIQEKIDLEIRMREGIWKLLSLSTQKDQVLHAVKNLMVCNARLMAYTS      1 - 70
ELQKLEEQIANQTGRCDVKFESKERTACKGKIAISDIRIPLMWKDSDHFSNKERSRRYAIFCLFKMGANV     71 - 140
FDTDVVNVDKTITDICFENVTIFNEAGPDFQIKVEVYSCCTEESSITNTPKKLAKKLKTSISKATGKKIS    141 - 210
SVLQEEDDEMCLLLSSAVFGVKYNLLAHTTLTLESAEDSFKTHNLSINGNEESSFWLPLYGNMCCRLVAQ    211 - 280
PACMAEDAFAGFLNQQQMVEGLISWRRLYCVLRGGKLYCFYSPEEIEAKVEPALVVPINKETRIRAMDKD    281 - 350
AKKRIHNFSVINPVPGQAITQIFAVDNREDLQKWMEAFWQHFFDLSQWKHCCEELMKIEIMSPRKPPLFL    351 - 420
TKEATSVYHDMSIDSPMKLESLTDIIQKKIEETNGQFLIGQHEESLPPPWATLFDGNHQMVIQKKVLYPA    421 - 490
SEPLHDEKGKKRQAPLPPSDKLPFSLKSQSNTDQLVKDNWGKTSVSQTSSLDTKLSTLMHHLQKPMAAPR    491 - 560
KLLPARRNRLSDGEHTDTKTNFEAKPVPAPRQKSIKDILDPRSWLQAQV                         561 - 609
//

Text Mined References (16)

PMID Year Title