Property Summary

NCBI Gene PubMed Count 38
PubMed Score 103.35
PubTator Score 75.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma 1.300 6.0e-04
Astrocytoma, Pilocytic 1.400 8.0e-05
Breast cancer 1.500 1.9e-04
breast carcinoma 1.200 1.8e-17
cutaneous lupus erythematosus 4.900 1.0e-05
cystic fibrosis 2.800 8.2e-04
dermatomyositis 2.500 1.4e-02
ependymoma 1.500 1.4e-03
glioblastoma 1.100 2.1e-03
invasive ductal carcinoma 1.423 4.7e-03
juvenile dermatomyositis 4.317 4.8e-18
lung cancer -3.100 4.0e-05
lung carcinoma -1.500 8.9e-08
malignant mesothelioma 3.100 7.5e-07
Multiple Sclerosis 4.000 3.2e-03
nasopharyngeal carcinoma 1.400 7.9e-03
ovarian cancer 1.600 6.6e-03
pancreatic cancer 1.300 2.4e-03
primary Sjogren syndrome 1.500 3.1e-04
psoriasis 2.100 1.0e-04
Systemic lupus erythematosus 2.200 4.2e-04

Gene RIF (37)

AA Sequence

MWVLTPAAFAGKLLSVFRQPLSSLWRSLVPLFCWLRATFWLLATKRRKQQLVLRGPDETKEEEEDPPLPT      1 - 70
TPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLV     71 - 140
RFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRW    141 - 210
CRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFL    211 - 280
ERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKY    281 - 350
IWSKADLKLDW                                                               351 - 361
//

Text Mined References (45)

PMID Year Title