Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

AA Sequence

MEPGSVENLSIVYRSRDFLVVNKHWDVRIDSKAWRETLTLQKQLRYRFPELADPDTCYGFRFCHQLDFST      1 - 70
SGALCVALNKAAAGSAYRCFKERRVTKAYLALLRGHIQESRVTISHAIGRNSTEGRAHTMCIEGSQGCEN     71 - 140
PKPSLTDLVVLEHGLYAGDPVSKVLLKPLTGRTHQLRVHCSALGHPVVGDLTYGEVSGREDRPFRMMLHA    141 - 210
FYLRIPTDTECVEVCTPDPFLPSLDACWSPHTLLQSLDQLVQALRATPDPDPEDRGPRPGSPSALLPGPG    211 - 280
RPPPPPTKPPETEAQRGPCLQWLSEWTLEPDS                                          281 - 312
//

Text Mined References (7)

PMID Year Title