Property Summary

NCBI Gene PubMed Count 114
PubMed Score 982.02
PubTator Score 216.34

Knowledge Summary

Patent

No data available

Expression

PDB (10)

Gene RIF (74)

AA Sequence

MSGALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIEN      1 - 70
PADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYV     71 - 140
NLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEI    141 - 210
EKEEQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSEGVQVPSVPIQQFPTEDWSAQPATEDWSAAP    211 - 280
TAQATEWVGATTDWS                                                           281 - 295
//

Text Mined References (135)

PMID Year Title