Property Summary

NCBI Gene PubMed Count 18
PubMed Score 148.96
PubTator Score 58.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Kidney disease 397 0.0 1.0
Osteoporosis 259 0.0 2.0
diabetes mellitus 1663 0.0 1.0
Disease Target Count Z-score Confidence
Theileriasis 13 3.657 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.400 1.2e-03

Gene RIF (2)

PMID Text
23546393 Our findings provide the first demonstration that RPS12 plays important roles in regulating the proliferation and migration of gastric cancer cells. S100A4 can mediate the effects of RPS12 as a downstream effector
11870519 may be early molecular diagnostic marker for cervical squamous cell carcinoma

AA Sequence

MAEEGIAAGGVMDVNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALCA      1 - 70
EHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKDYGKESQAKDVIEEYFKCKK             71 - 132
//

Text Mined References (29)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23546393 2013 RPS12-specific shRNA inhibits the proliferation, migration of BGC823 gastric cancer cells with S100A4 as a downstream effector.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
21150874 2011 A genome-wide association study for diabetic nephropathy genes in African Americans.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
15883184 2005 Mass spectrometric analysis of the human 40S ribosomal subunit: native and HCV IRES-bound complexes.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15189156 2004 The molecular mechanics of eukaryotic translation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12588972 2003 Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11875025 2002 The human ribosomal protein genes: sequencing and comparative analysis of 73 genes.
11790298 2002 Directed proteomic analysis of the human nucleolus.
9582194 1998 A map of 75 human ribosomal protein genes.
8722009 Structure and evolution of mammalian ribosomal proteins.
8706699 1996 Characterization of the human small-ribosomal-subunit proteins by N-terminal and internal sequencing, and mass spectrometry.
7821789 1994 Construction of a human full-length cDNA bank.
1861993 1991 cDNA and predicted amino acid sequences of the human ribosomal protein genes rpS12 and rpL17.
1712897 1991 Ribosomal protein genes are overexpressed in colorectal cancer: isolation of a cDNA clone encoding the human S3 ribosomal protein.