Property Summary

NCBI Gene PubMed Count 28
PubMed Score 24.09
PubTator Score 7.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus -1.400 1.6e-03
lung cancer -3.400 4.1e-02
Multiple myeloma 1.218 2.0e-03
sonic hedgehog group medulloblastoma 1.100 3.7e-05

Protein-protein Interaction (5)

Gene RIF (1)

AA Sequence

MADIQTERAYQKQPTIFQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKEAIEGTYIDKKCPFTGNVSIRG      1 - 70
RILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDVQIGDIVTVGECRPLSKTVRF     71 - 140
NVLKVTKAAGTKKQFQKF                                                        141 - 158
//

Text Mined References (40)

PMID Year Title