Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MAKCTKKVGGIVSKYRTHHGASLWKMVKEIEISQHTKYTCSFCGKTKMKRRAVKIRHCNSCMKTVAGSAW      1 - 70
TYNTTSAVMVKSAIRRLKELKDQ                                                    71 - 93
//

Text Mined References (3)

PMID Year Title
19123937 2009 Comparative analysis of processed ribosomal protein pseudogenes in four mammalian genomes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
11181995 2001 The sequence of the human genome.