Property Summary

NCBI Gene PubMed Count 31
PubMed Score 25.27
PubTator Score 9.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Retinitis pigmentosa 10 6 4.192 2.1
Hereditary spherocytosis type 4 18 3.045 1.5
Disease Target Count
Diamond-Blackfan anemia 31

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.600 9.4e-05
atypical teratoid / rhabdoid tumor -1.800 9.1e-09
Breast cancer -1.100 1.4e-12
cystic fibrosis -1.300 2.6e-04
ependymoma -1.200 2.0e-02
glioblastoma -1.200 3.8e-05
group 4 medulloblastoma -1.200 1.0e-03
intraductal papillary-mucinous neoplasm ... -1.200 1.2e-02
lung adenocarcinoma -1.100 1.1e-15
medulloblastoma, large-cell -1.100 1.7e-03
Multiple myeloma 1.935 2.1e-05
osteosarcoma -1.337 1.0e-04
ovarian cancer -2.000 1.1e-05
subependymal giant cell astrocytoma -1.350 3.4e-02
Waldenstrons macroglobulinemia 1.576 9.2e-04

Gene RIF (7)

AA Sequence

MGAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGG      1 - 70
RKRPVPKGATYGKPVHHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYWVGEDSTYKFFEVILIDPFHK     71 - 140
AIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGLGKGHKFHHTIGGSRRAAWRRRNTLQLHRYR          141 - 204
//

Text Mined References (42)

PMID Year Title