1. Home
  2. Targets
  3. nucleic acid binding
  4. RNA binding protein
  5. ribosomal protein
  6. 60S ribosomal protein L13a

Tbio 60S ribosomal protein L13a

Associated with ribosomes but is not required for canonical ribosome function and has extra-ribosomal functions. Component of the GAIT (gamma interferon-activated inhibitor of translation) complex which mediates interferon-gamma-induced transcript-selective translation inhibition in inflammation processes. Upon interferon-gamma activation and subsequent phosphorylation dissociates from the ribosome and assembles into the GAIT complex which binds to stem loop-containing GAIT elements in the 3'-UTR of diverse inflammatory mRNAs (such as ceruplasmin) and suppresses their translation. In the GAIT complex interacts with m7G cap-bound eIF4G at or near the eIF3-binding site and blocks the recruitment of the 43S ribosomal complex. Involved in methylation of rRNA.

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a member of the L13P family of ribosomal proteins that is a component of the 60S subunit. The encoded protein also plays a role in the repression of inflammatory genes as a component of the IFN-gamma-activated inhibitor of translation (GAIT) complex. This gene is co-transcribed with the small nucleolar RNA genes U32, U33, U34, and U35, which are located in the second, fourth, fifth, and sixth introns, respectively. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed throughout the genome. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]

 Comments

Property Summary

NCBI Gene PubMed Count 36
PubMed Score 63.24
PubTator Score 28.70

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P40429 A8K505
Symbols L13A
TSTA1

Gene

RPL13A

PANTHER Protein Class (3)

PDB

4UG0   4V6X   5AJ0  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (11)

See all...

 GO Function (3)

 GO Component (10)

 GO Process (9)

 Compartment GO Term (42)

See all...

 MGI Phenotype (7)

 HCA RNA Cell Line (56)

See all...

Pathway (32)

See all...

Protein-protein Interaction (78)

EIF3F   EIF3D   EIF3H   EIF3G   EIF3J   EIF2S1   EIF4E   RPL35A   RPL7   RPL17   EIF2S2   EIF4B   RPL9   RPL22   RPL4   RPL3   EIF2S3   RPL35   SSR1   RPL27A   RPL5   RPL21   RPL28   EIF1AX   RPL29   RPL34   RPL14   EIF5   EIF3B   SEC61G   EIF3E   EIF4A1   SPCS3   RPL26   RPL15   RPL27   RPL37A   RPL37   RPL7A   RPL23A   RPL23   RPL30   RPL39   RPL31   RPL32   RPL8   RPL41   UBA52   RPL38   RPL24   RPL36A   RPL19   RPL18A   RPL6   EIF4G1   RPL18   EIF3I   EIF3A   EIF4A2   EIF4H   RNPS1   EIF3M   SMG6   GSPT2   SMG8   MAGOHB   ERO1A   SMG1   EIF3C   UPF3B   SMG9   UPF3A   UPF2   EIF3K   SRP68   TRMT112   SMG5   RPL36  

Gene RIF (9)

PMID Text
23689135 This work identified the arginine residue at position 68 of L13A as being essential for L13A binding to rRNA and incorporation into ribosomes.
22771119 GAPDH functions as a chaperone, shielding newly released RPL13a from proteasomal degradation.
22533734 Ribosomal protein l13a is a reference gene for human bone marrow-derived mesenchymal stromal cells during expansion, adipo-, chondro-, and osteogenesis
21114473 The study found two ribosomal proteins, RPS7 and RPL13A that interact with the HMG (high-mobility group) box domain of SRY.
20716364 Data show that EF1alpha, RPL13a and YWHAZ are suitable genes for the RT-qPCR analysis and comparison of several sources of human MSC during in vitro characterization and differentiation as well as in an ex vivo animal model of global cerebral ischemia.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17921318 L13a may have evolved from an essential ribosomal protein in lower eukaryotes to having a role as a dispensable extra-ribosomal function in higher eukaryotes.
14567916 A translational silencing mechanism involving regulated release of RPL13a and subsequent binding to its target mRNA was elucidated.

AA Sequence 

MAEVQVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGP      1 - 70
YHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGR     71 - 140
LAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKYTEVLKTHGLLV           141 - 203
//

Text Mined References (43)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23689135 2013 Insights into the mechanism of ribosomal incorporation of mammalian L13a protein during ribosome biogenesis.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23071094 2012 Heterotrimeric GAIT complex drives transcript-selective translation inhibition in murine macrophages.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22771119 2012 Protection of extraribosomal RPL13a by GAPDH and dysregulation by S-nitrosylation.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22533734 2012 Ribosomal protein l13a as a reference gene for human bone marrow-derived mesenchymal stromal cells during expansion, adipo-, chondro-, and osteogenesis.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
21114473 2011 SRY interacts with ribosomal proteins S7 and L13a in nuclear speckles.
20716364 2010 EF1alpha and RPL13a represent normalization genes suitable for RT-qPCR analysis of bone marrow derived mesenchymal stem cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18995835 2008 DAPK-ZIPK-L13a axis constitutes a negative-feedback module regulating inflammatory gene expression.
18809582 2008 Nucleophosmin serves as a rate-limiting nuclear export chaperone for the Mammalian ribosome.
17921318 2007 Human ribosomal protein L13a is dispensable for canonical ribosome function but indispensable for efficient rRNA methylation.
17218275 2007 L13a blocks 48S assembly: role of a general initiation factor in mRNA-specific translational control.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16791210 2006 Dynamic proteomics in individual human cells uncovers widespread cell-cycle dependence of nuclear proteins.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15479637 2004 Noncanonical function of glutamyl-prolyl-tRNA synthetase: gene-specific silencing of translation.
15189156 2004 The molecular mechanics of eukaryotic translation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14567916 2003 Regulated release of L13a from the 60S ribosomal subunit as a mechanism of transcript-specific translational control.
12962325 2003 Characterization and analysis of posttranslational modifications of the human large cytoplasmic ribosomal subunit proteins by mass spectrometry and Edman sequencing.
12588972 2003 Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11875025 2002 The human ribosomal protein genes: sequencing and comparative analysis of 73 genes.
11790298 2002 Directed proteomic analysis of the human nucleolus.
10580157 1999 Gene organization and sequence of the region containing the ribosomal protein genes RPL13A and RPS11 in the human genome and conserved features in the mouse genome.
9582194 1998 A map of 75 human ribosomal protein genes.
8764399 1996 Intron-encoded, antisense small nucleolar RNAs: the characterization of nine novel species points to their direct role as guides for the 2'-O-ribose methylation of rRNAs.
8722009 Structure and evolution of mammalian ribosomal proteins.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
1282492 1992 Conservation of a 23-kDa human transplantation antigen in mammalian species.