Property Summary

NCBI Gene PubMed Count 28
PubMed Score 69.10
PubTator Score 28.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -3.300 1.3e-05
Alzheimer's disease -1.700 3.2e-02
astrocytic glioma -2.500 3.4e-03
Astrocytoma, Pilocytic -3.800 2.0e-12
atypical teratoid / rhabdoid tumor -4.300 1.6e-07
Down syndrome -1.400 2.6e-03
ependymoma -2.300 8.9e-03
glioblastoma -3.400 1.2e-08
group 3 medulloblastoma -2.800 1.6e-03
lung carcinoma 3.000 7.5e-35
medulloblastoma, large-cell -4.000 3.0e-06
oligodendroglioma -1.200 5.0e-02
Pick disease -1.600 6.4e-03
primitive neuroectodermal tumor -4.200 1.3e-05
subependymal giant cell astrocytoma -3.246 1.6e-02

Gene RIF (6)

AA Sequence

MTDTVFSNSSNRWMYPSDRPLQSNDKEQLQAGWSVHPGGQPDRQRKQEELTDEEKEIINRVIARAEKMEE      1 - 70
MEQERIGRLVDRLENMRKNVAGDGVNRCILCGEQLGMLGSACVVCEDCKKNVCTKCGVETNNRLHSVWLC     71 - 140
KICIEQREVWKRSGAWFFKGFPKQVLPQPMPIKKTKPQQPVSEPAAPEQPAPEPKHPARAPARGDSEDRR    141 - 210
GPGQKTGPDPASAPGRGNYGPPVRRASEARMSSSSRDSESWDHSGGAGDSSRSPAGLRRANSVQASRPAP    211 - 280
GSVQSPAPPQPGQPGTPGGSRPGPGPAGRFPDQKPEVAPSDPGTTAPPREERTGGVGGYPAVGAREDRMS    281 - 350
HPSGPYSQASAAAPQPAAARQPPPPEEEEEEANSYDSDEATTLGALEFSLLYDQDNSSLQCTIIKAKGLK    351 - 420
PMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPIWNETLVYHGITDEDMQRKTLRISVCDEDKFGH    421 - 490
NEFIGETRFSLKKLKPNQRKNFNICLERVIPMKRAGTTGSARGMALYEEEQVERVGDIEERGKILVSLMY    491 - 560
STQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKHKTQIKKKTLNPEFNEEFFYDIKHSDL    561 - 630
AKKSLDISVWDYDIGKSNDYIGGCQLGISAKGERLKHWYECLKNKDKKIERWHQLQNENHVSSD          631 - 694
//

Text Mined References (29)

PMID Year Title