Property Summary

NCBI Gene PubMed Count 19
PubMed Score 31.80
PubTator Score 7.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.200 1.0e-02
non-small cell lung cancer 1.246 1.3e-20
lung cancer 1.700 4.0e-04
active Crohn's disease 1.115 1.6e-02
posterior fossa group B ependymoma 1.300 2.5e-05
lung adenocarcinoma 1.120 1.4e-04
ovarian cancer 1.300 1.6e-03
pituitary cancer 1.400 2.8e-05

Gene RIF (6)

PMID Text
23159623 this study investigated the interaction between RPAP3 and PIH1D1.
21184742 These results indicate that RPAP3 may be a novel modulator of NF-kappaB pathway in apoptosis induced by anti-cancer chemotherapeutic agents.
20864038 Data indicate that RNA polymerase II is built in the cytoplasm and reveal quality-control mechanisms that link HSP90 and its cochaperone hSpagh (RPAP3) to the nuclear import of fully assembled enzymes.
19450687 Is part of an RNA polymerase II-associated complex with possible chaperone activity.
19180575 RPAP3 interacts with Reptin to modulate UV-induced DNA damage by regulating H2AX phosphorylation
18538670 Overexpression of RPAP3 in HEK 293 cells potentiated caspase-3 activation and apoptosis.

AA Sequence

MTSANKAIELQLQVKQNAEELQDFMRDLENWEKDIKQKDMELRRQNGVPEENLPPIRNGNFRKKKKGKAK      1 - 70
ESSKKTREENTKNRIKSYDYEAWAKLDVDRILDELDKDDSTHESLSQESESEEDGIHVDSQKALVLKEKG     71 - 140
NKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAA    141 - 210
RFALQKLEEAKKDYERVLELEPNNFEATNELRKISQALASKENSYPKEADIVIKSTEGERKQIEAQQNKQ    211 - 280
QAISEKDRGNGFFKEGKYERAIECYTRGIAADGANALLPANRAMAYLKIQKYEEAEKDCTQAILLDGSYS    281 - 350
KAFARRGTARTFLGKLNEAKQDFETVLLLEPGNKQAVTELSKIKKELIEKGHWDDVFLDSTQRQNVVKPI    351 - 420
DNPPHPGSTKPLKKVIIEETGNLIQTIDVPDSTTAAAPENNPINLANVIAATGTTSKKNSSQDDLFPTSD    421 - 490
TPRAKVLKIEEVSDTSSLQPQASLKQDVCQSYSEKMPIEIEQKPAQFATTVLPPIPANSFQLESDFRQLK    491 - 560
SSPDMLYQYLKQIEPSLYPKLFQKNLDPDVFNQIVKILHDFYIEKEKPLLIFEILQRLSELKRFDMAVMF    561 - 630
MSETEKKIARALFNHIDKSGLKDSSVEELKKRYGG                                       631 - 665
//

Text Mined References (32)

PMID Year Title
26711270 2015 A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25241763 2014 Meta-analysis of genome-wide association studies identifies novel loci that influence cupping and the glaucomatous process.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23159623 2013 RPAP3 splicing variant isoform 1 interacts with PIH1D1 to compose R2TP complex for cell survival.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21360678 2011 Label-free quantitative proteomics and SAINT analysis enable interactome mapping for the human Ser/Thr protein phosphatase 5.
21269460 2011 Initial characterization of the human central proteome.
21184742 2011 RPAP3 enhances cytotoxicity of doxorubicin by impairing NF-kappa B pathway.
21078300 2010 PIH1D1, a subunit of R2TP complex, inhibits doxorubicin-induced apoptosis.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20864038 2010 HSP90 and its R2TP/Prefoldin-like cochaperone are involved in the cytoplasmic assembly of RNA polymerase II.
20864032 2010 CK2 phospho-dependent binding of R2TP complex to TEL2 is essential for mTOR and SMG1 stability.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19875381 2010 A proteomic investigation of ligand-dependent HSP90 complexes reveals CHORDC1 as a novel ADP-dependent HSP90-interacting protein.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19450687 2009 High-resolution mapping of the protein interaction network for the human transcription machinery and affinity purification of RNA polymerase II-associated complexes.
19180575 2009 RPAP3 interacts with Reptin to regulate UV-induced phosphorylation of H2AX and DNA damage.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18538670 2008 Molecular cloning of novel Monad binding protein containing tetratricopeptide repeat domains.
17643375 2007 Systematic analysis of the protein interaction network for the human transcription machinery reveals the identity of the 7SK capping enzyme.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.