Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.02
PubTator Score 9.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Breast cancer 3098 7.0e-14
osteosarcoma 7933 1.1e-12
medulloblastoma, large-cell 6234 1.5e-05
adult high grade glioma 2148 2.1e-03
active ulcerative colitis 477 2.1e-02
spina bifida 1064 3.6e-02
Disease Target Count Z-score Confidence
Behcet's disease 74 3.108 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -3.317 1.1e-12
medulloblastoma, large-cell 1.300 1.5e-05
active ulcerative colitis 1.319 2.1e-02
adult high grade glioma 1.200 2.1e-03
spina bifida -2.368 3.6e-02
Breast cancer -1.500 7.0e-14

Gene RIF (5)

PMID Text
20875797 these findings suggest that RNF39 and TRIM39 are involved in the etiology of Behcet's disease.
20593013 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19693088 Observational study of gene-disease association. (HuGE Navigator)
19050382 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MWWRDLTRLRLWLKREAIPGEGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEGAASRSWLSMD      1 - 70
APELGPGLVERLEQLATCPLCGGSFEDPVLLACEHSFCRACLARRWGTPPATGTEASPTACPCCGLPCPR     71 - 140
RSLRSNVRLAVEVRISRELREKLAEPGARAGRRRGGRIPTMGCLDLPGEDMRKTWRRFEVPTSKSSNSED    141 - 210
DLPEDYPVVKKMLHRLTADLTLDPGTAHRRLLISADRRSVQLAPPGTPAPPDGPKRFDQLPAVLGAQGFG    211 - 280
AGRHCWEVETADAASCRDSSGEDADDEESHYAVGAAGESVQRKGCVRLCPAGAVWAVEGRGGRLWALTAP    281 - 350
EPTLLGGVEPPPRRIRVDLDWERGRVAFYDGRSLDLLYAFQAPGPLGERIFPLFCTCDPRAPLRIVPAES    351 - 420
//

Text Mined References (16)

PMID Year Title
24489884 2014 Genome-wide association study of proneness to anger.
20875797 2010 TRIM39 and RNF39 are associated with Behçet's disease independently of HLA-B?51 and -A?26.
20593013 2010 A major histocompatibility Class I locus contributes to multiple sclerosis susceptibility independently from HLA-DRB1*15:01.
20041166 2009 Common genetic variation and the control of HIV-1 in humans.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19693088 2009 The HLA-B/-C haplotype block contains major determinants for host control of HIV.
19115949 2009 Genomewide association study of an AIDS-nonprogression cohort emphasizes the role played by HLA genes (ANRS Genomewide Association Study 02).
19050382 2009 Association of HLA-C and HCP5 gene regions with the clinical course of HIV-1 infection.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11716498 2001 LIRF, a gene induced during hippocampal long-term potentiation as an immediate-early gene, encodes a novel RING finger protein.
11130983 2000 Transcriptional analysis of the 69-kb sequence centromeric to HLA-J: a dense and complex structure of five genes.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11006080 2000 Molecular cloning of testis-abundant finger Protein/Ring finger protein 23 (RNF23), a novel RING-B box-coiled coil-B30.2 protein on the class I region of the human MHC.
10585558 2000 Gene trapping of two novel genes, Hzf and Hhl, expressed in hematopoietic cells.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.