Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
psoriasis 6685 9.8e-29
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 1.0


  Differential Expression (1)

Disease log2 FC p
psoriasis 1.400 9.8e-29

AA Sequence

ALWPVQCALKTGNLRCLPLPPRPPATSTAASPLGPLTDN                                   211 - 249

Text Mined References (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.