Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.39
PubTator Score 1.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
dermatomyositis 1.100 1.4e-03
intraductal papillary-mucinous neoplasm ... 1.700 2.7e-02
lung cancer 1.200 6.1e-03
malignant mesothelioma 1.300 2.9e-06
psoriasis -1.200 1.4e-02
sonic hedgehog group medulloblastoma 1.300 4.3e-03
tuberculosis -1.100 3.5e-03

AA Sequence

MAQTVQNVTLSLTLPITCHICLGKVRQPVICINNHVFCSICIDLWLKNNSQCPACRVPITPENPCKEIIG      1 - 70
GTSESEPMLSHTVRKHLRKTRLELLHKEYEDEIDCLQKEVEELKSKNLSLESQIKTILDPLTLVQGNQNE     71 - 140
DKHLVTDNPSKINPETVAEWKKKLRTANEIYEKVKDDVDKLKEANKKLKLENGGLVRENLRLKAEVDNRS    141 - 210
PQKFGRFAVAALQSKVEQYERETNRLKKALERSDKYIEELESQVAQLKNSSEEKEAMNSICQTALSADGK    211 - 280
GSKGSEEDVVSKNQGDSARKQPGSSTSSSSHLAKPSSSRLCDTSSARQESTSKADLNCSKNKDLYQEQVE    281 - 350
VMLDVTDTSMDTYLEREWGNKPSDCVPYKDEELYDLPAPCTPLSLSCLQLSTPENRESSVVQAGGSKKHS    351 - 420
NHLRKLVFDDFCDSSNVSNKDSSEDDISRSENEKKSECFSSPKTGFWDCCSTSYAQNLDFESSEGNTIAN    421 - 490
SVGEISSKLSEKSGLCLSKRLNSIRSFEMNRTRTSSEASMDAAYLDKISELDSMMSESDNSKSPCNNGFK    491 - 560
SLDLDGLSKSSQGSEFLEEPDKLEEKTELNLSKGSLTNDQLENGSEWKPTSFFLLSPSDQEMNEDFSLHS    561 - 630
SSCPVTNEIKPPSCLFQTEFSQGILLSSSHRLFEDQRFGSSLFKMSSEMHSLHNHLQSPWSTSFVPEKRN    631 - 700
KNVNQSTKRKIQSSLSSASPSKATKS                                                701 - 726
//

Text Mined References (17)

PMID Year Title