Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.71
PubTator Score 6.02

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
acute myeloid leukemia 1.500 9.4e-03
adrenocortical carcinoma -1.176 3.7e-03
Bipolar Disorder 1.400 4.6e-02
Gaucher disease type 1 1.200 7.0e-03
lung cancer -2.200 4.2e-04
pancreatic cancer 1.200 1.2e-02
primary pancreatic ductal adenocarcinoma 1.090 1.4e-02
psoriasis -2.100 6.5e-05
tuberculosis and treatment for 3 months -1.100 4.5e-06
urothelial carcinoma -1.200 1.9e-03

Gene RIF (1)

AA Sequence

MGSEKDSESPRSTSLHAAAPDPKCRSGGRRRRLTLHSVFSASARGRRARAKPQAEPPPPAAQPPPAPAPA      1 - 70
AAQGPPPEALPAEPAAEAEAEAAAAAAEPGFDDEEAAEGGGPGAEEVECPLCLVRLPPERAPRLLSCPHR     71 - 140
SCRDCLRHYLRLEISESRVPISCPECSERLNPHDIRLLLADPPLMHKYEEFMLRRYLASDPDCRWCPAPD    141 - 210
CGYAVIAYGCASCPKLTCEREGCQTEFCYHCKQIWHPNQTCDMARQQRAQTLRVRTKHTSGLSYGQESGP    211 - 280
ADDIKPCPRCSAYIIKMNDGSCNHMTCAVCGCEFCWLCMKEISDLHYLSPSGCTFWGKKPWSRKKKILWQ    281 - 350
LGTLIGAPVGISLIAGIAIPAMVIGIPVYVGRKIHSRYEGRKTSKHKRNLAITGGVTLSVIASPVIAAVS    351 - 420
VGIGVPIMLAYVYGVVPISLCRGGGCGVSTANGKGVKIEFDEDDGPITVADAWRALKNPSIGESSIEGLT    421 - 490
SVLSTSGSPTDGLSVMQGPYSETASFAALSGGTLSGGILSSGKGKYSRLEVQADVQKEIFPKDTASLGAI    491 - 560
SDNASTRAMAGSIISSYNPQDRECNNMEIQVDIEAKPSHYQLVSGSSTEDSLHVHAQMAENEEEGSGGGG    561 - 630
SEEDPPCRHQSCEQKDCLASKPWDISLAQPESIRSDLESSDAQSDDVPDITSDECGSPRSHTAACPSTPR    631 - 700
AQGAPSPSAHMNLSALAEGQTVLKPEGGEARV                                          701 - 732
//

Text Mined References (14)

PMID Year Title