Property Summary

NCBI Gene PubMed Count 24
PubMed Score 20.56
PubTator Score 21.81

Knowledge Summary

Patent

No data available

Gene RIF (16)

PMID Text
24852021 BCA2 functions as an antiviral factor that targets HIV-1 Gag for degradation, impairing virus assembly and release.
24852021 Increased levels of ubiquitinated BCA2 are found in the presence of HIV-1 Gag, suggesting that the auto-ubiquitination activity of BCA2 increases in the absence of target proteins
24852021 Knockdown of BCA2 by shRNA enhances HIV-1 replication in Jurkat CD4+ T cells
24403860 BCA2 is an endogenous inhibitor of AMPK activation in breast cancer cells and BCA2 inhibition increases the efficacy of metformin.
24027428 BCA2, a potential oncogenic E3 ubiquitin ligase, promotes breast cancer cell proliferation partially through targeting p21 for ubiquitination and proteasomal degradation.
23418353 RNF126 and Rabring7 play a role in the ubiquitin-dependent sorting and downregulation of membrane receptors.
23242606 High BCA2 expression is associated with renal oncocytoma.
22850893 BCA2 is therefore a newly identified transcriptional target of estrogen receptor.
22844532 Rabring7 stimulates c-Myc degradation via mono-ubiquitination of MM-1
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20019814 BCA2 accelerates the internalization and degradation of viral particles following their tethering to the cell surface and is a co-factor or enhancer for the tetherin-dependent restriction of HIV-1 release from infected cells.
20019814 Increased levels of ubiquitinated BCA2 are found in the presence of HIV-1 Gag, suggesting that the auto-ubiquitination activity of BCA2 increases in the absence of target proteins
17462600 These results suggest that Rabring7 is involved in the endocytic trafficking of EGFR through its E3 ligase activity.
16925951 BCA2 E3 ligase is coregulated with estrogen receptor and plays a role in the regulation of epidermal growth factor receptor (EGF-R) trafficking
16288031 The autoubiquitination activity of BCA2 indicates that it is a novel RING-type E3 ligase.

AA Sequence

MAEASAAGADSGAAVAAHRFFCHFCKGEVSPKLPEYICPRCESGFIEEVTDDSSFLGGGGSRIDNTTTTH      1 - 70
FAELWGHLDHTMFFQDFRPFLSSSPLDQDNRANERGHQTHTDFWGARPPRLPLGRRYRSRGSSRPDRSPA     71 - 140
IEGILQHIFAGFFANSAIPGSPHPFSWSGMLHSNPGDYAWGQTGLDAIVTQLLGQLENTGPPPADKEKIT    141 - 210
SLPTVTVTQEQVDMGLECPVCKEDYTVEEEVRQLPCNHFFHSSCIVPWLELHDTCPVCRKSLNGEDSTRQ    211 - 280
SQSTEASASNRFSNDSQLHDRWTF                                                  281 - 304
//

Text Mined References (26)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24852021 2014 BCA2/Rabring7 targets HIV-1 Gag for lysosomal degradation in a tetherin-independent manner.
24403860 2013 Regulation of metformin response by breast cancer associated gene 2.
24027428 2013 RNF115/BCA2 E3 ubiquitin ligase promotes breast cancer cell proliferation through targeting p21Waf1/Cip1 for ubiquitin-mediated degradation.
23962720 2014 A genome-wide association study and biological pathway analysis of epilepsy prognosis in a prospective cohort of newly treated epilepsy.
23418353 2013 The E3 ubiquitin ligases RNF126 and Rabring7 regulate endosomal sorting of the epidermal growth factor receptor.
23242606 2013 BCA2 is differentially expressed in renal oncocytoma: an analysis of 158 renal neoplasms.
22850893 2012 Transcriptional activation of breast cancer-associated gene 2 by estrogen receptor.
22844532 2012 Rabring7 degrades c-Myc through complex formation with MM-1.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20019814 2009 BCA2/Rabring7 promotes tetherin-dependent HIV-1 restriction.
19690564 2009 A comprehensive framework of E2-RING E3 interactions of the human ubiquitin-proteasome system.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
18819927 2008 Autoubiquitination of BCA2 RING E3 ligase regulates its own stability and affects cell migration.
17462600 2007 Involvement of Rabring7 in EGF receptor degradation as an E3 ligase.
16925951 2006 Novel RING E3 ubiquitin ligases in breast cancer.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16288031 2005 A novel RING-type ubiquitin ligase breast cancer-associated gene 2 correlates with outcome in invasive breast cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12972561 2003 Rabring7, a novel Rab7 target protein with a RING finger motif.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.