Property Summary

NCBI Gene PubMed Count 41
PubMed Score 23.90
PubTator Score 33.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Dermatitis, Atopic 45
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Renal fibrosis 4 3.352 1.7
Ureteral obstruction 6 3.216 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell -1.400 2.2e-05
intraductal papillary-mucinous neoplasm ... 1.200 2.5e-02
ovarian cancer 1.600 2.7e-03

 GWAS Trait (1)

Gene RIF (22)

PMID Text
26656854 Study reports that the monomeric RING domains from the human E3 ligases Arkadia and Ark2C bind directly to free ubiquitin with an affinity comparable to that of other dedicated ubiquitin-binding domains.
26238425 Results suggest that -459CpG methylation in Sp1-binding site of RNF111 promoter transcriptionally decreases RNF111 expression, which inhibits TGF-beta/Smad signaling associated invasion in NSCLC cells.
26151477 These data suggest that RNF111, together with the CRL4(DDB2) ubiquitin ligase complex, is responsible for sequential XPC ubiquitylation, which regulates the recruitment and release of XPC and is crucial for efficient progression of the NER reaction.
24912682 Arkadia can both promote and inhibit gene expression, indicating that Arkadia's activity in transcriptional control may depend on the epigenetic context, defined by Polycomb repressive complexes and DNA methylation.
23751493 Our findings establish RNF111 as a new STUbL that directly links nonproteolytic ubiquitylation and SUMOylation in the DNA damage response.
23530056 Arkadia is involved in arsenic-induced degradation of polysumoylated PML protein.
23467611 findings indicate that Arkadia is not critical for regulating tumor growth per se, but is required for the early stages of cancer cell colonization at the sites of metastasis
23394999 RNF111-dependent neddylation activates DNA damage-induced ubiquitination
23246292 We established that ARX polyA alterations damage the regulation of KDM5C expression.
23212909 FHL2 increases the stability of the TGF-beta pathway positive regulator Arkadia by inhibiting its ubiquitination and cooperates with Arkadia to activate TGF-beta signaling.
22411132 Determined the nuclear magnetic resonance solution structure of Arkadia's RING-H2 domain and revealed a (beta)betabetaalpha fold, fully consistent with the expected "cross-brace" mode of Zn(II)-ligation.
21998011 Arkadia enhances transforming growth factor-beta signaling responses and supports its tumor-suppressing properties in colorectal cancer.
21795712 RB1CC1 thus appears to play a unique role as a modulator of TGF-beta signaling by restricting substrate specificity of Arkadia.
20965945 Arkadia complexes with clathrin adaptor AP2 and regulates EGF signalling.
19959502 findings show that Arkadia regulates the levels of expression of c-Ski protein in cell-type-dependent fashion, and exhibits a tumour suppressor function by inhibiting tumour cell growth
19898560 Arkadia protein intensifies TGF-beta-induced effects by marking c-Ski and inhibitory Smad7 for destruction--REVIEW
18059455 Arkadia stimulates renal tubular epithelial to mesenchymal cell transition through degradation of Smad7.
17591695 Results show that Arkadia specifically activates transcription via Smad3/Smad4 binding sites by inducing degradation of the transcriptional repressor SnoN.
17510063 Arkadia induces degradation of SnoN and c-Ski in addition to Smad7.
14657019 Silencing of the Arkadia gene resulted in repression of transcriptional activities induced by TGF-beta and BMP, and accumulation of the Smad7 protein.
11298453 Functional analysis of the mouse counterpart
11298452 Functional analysis of the mouse counterpart

AA Sequence

MSQWTPEYNELYTLKVDMKSEIPSDAPKTQESLKGILLHPEPIGAAKSFPAGVEMINSKVGNEFSHLCDD      1 - 70
SQKQEKEMNGNQQEQEKSLVVRKKRKSQQAGPSYVQNCVKENQGILGLRQHLGTPSDEDNDSSFSDCLSS     71 - 140
PSSSLHFGDSDTVTSDEDKEVSVRHSQTILNAKSRSHSARSHKWPRTETESVSGLLMKRPCLHGSSLRRL    141 - 210
PCRKRFVKNNSSQRTQKQKERILMQRKKREVLARRKYALLPSSSSSSENDLSSESSSSSSTEGEEDLFVS    211 - 280
ASENHQNNPAVPSGSIDEDVVVIEASSTPQVTANEEINVTSTDSEVEIVTVGESYRSRSTLGHSRSHWSQ    281 - 350
GSSSHASRPQEPRNRSRISTVIQPLRQNAAEVVDLTVDEDEPTVVPTTSARMESQATSASINNSNPSTSE    351 - 420
QASDTASAVTSSQPSTVSETSATLTSNSTTGTSIGDDSRRTTSSAVTETGPPAMPRLPSCCPQHSPCGGS    421 - 490
SQNHHALGHPHTSCFQQHGHHFQHHHHHHHTPHPAVPVSPSFSDPACPVERPPQVQAPCGANSSSGTSYH    491 - 560
EQQALPVDLSNSGIRSHGSGSFHGASAFDPCCPVSSSRAAIFGHQAAAAAPSQPLSSIDGYGSSMVAQPQ    561 - 630
PQPPPQPSLSSCRHYMPPPYASLTRPLHHQASACPHSHGNPPPQTQPPPQVDYVIPHPVHAFHSQISSHA    631 - 700
TSHPVAPPPPTHLASTAAPIPQHLPPTHQPISHHIPATAPPAQRLHPHEVMQRMEVQRRRMMQHPTRAHE    701 - 770
RPPPHPHRMHPNYGHGHHIHVPQTMSSHPRQAPERSAWELGIEAGVTAATYTPGALHPHLAHYHAPPRLH    771 - 840
HLQLGALPLMVPDMAGYPHIRYISSGLDGTSFRGPFRGNFEELIHLEERLGNVNRGASQGTIERCTYPHK    841 - 910
YKKVTTDWFSQRKLHCKQDGEEGTEEDTEEKCTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCP    911 - 980
ICRVDIEAQLPSES                                                            981 - 994
//

Text Mined References (44)

PMID Year Title
26656854 2016 Secondary ubiquitin-RING docking enhances Arkadia and Ark2C E3 ligase activity.
26238425 2015 RNF111/Arkadia is regulated by DNA methylation and affects TGF-?/Smad signaling associated invasion in NSCLC cells.
26151477 2015 SUMO and ubiquitin-dependent XPC exchange drives nucleotide excision repair.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25260751 2014 The MEKK1 PHD ubiquitinates TAB1 to activate MAPKs in response to cytokines.
24912682 2014 Multiple Arkadia/RNF111 structures coordinate its Polycomb body association and transcriptional control.
24047820 2013 Common variation contributes to the genetic architecture of social communication traits.
23751493 2013 RNF111/Arkadia is a SUMO-targeted ubiquitin ligase that facilitates the DNA damage response.
23530056 2013 Arkadia, a novel SUMO-targeted ubiquitin ligase involved in PML degradation.
23467611 2013 Arkadia regulates tumor metastasis by modulation of the TGF-? pathway.
23394999 2013 RNF111-dependent neddylation activates DNA damage-induced ubiquitination.
23246292 2013 A regulatory path associated with X-linked intellectual disability and epilepsy links KDM5C to the polyalanine expansions in ARX.
23212909 2013 The four and a half LIM-only protein 2 (FHL2) activates transforming growth factor ? (TGF-?) signaling by regulating ubiquitination of the E3 ligase Arkadia.
23086935 2012 Poly-small ubiquitin-like modifier (PolySUMO)-binding proteins identified through a string search.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
22411132 2012 NMR-based insights into the conformational and interaction properties of Arkadia RING-H2 E3 Ub ligase.
21998011 2011 Enhancement of TGF-? signaling responses by the E3 ubiquitin ligase Arkadia provides tumor suppression in colorectal cancer.
21795712 2011 RB1CC1 protein positively regulates transforming growth factor-beta signaling through the modulation of Arkadia E3 ubiquitin ligase activity.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21182207 2010 Variants in several genomic regions associated with asperger disorder.
20965945 2010 Arkadia complexes with clathrin adaptor AP2 and regulates EGF signalling.
20936779 2010 A human MAP kinase interactome.
19959502 2010 Context-dependent regulation of the expression of c-Ski protein by Arkadia in human cancer cells.
19898560 2009 c-Ski, Smurf2, and Arkadia as regulators of TGF-beta signaling: new targets for managing myofibroblast function and cardiac fibrosis.
19690564 2009 A comprehensive framework of E2-RING E3 interactions of the human ubiquitin-proteasome system.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
18059455 2008 Arkadia regulates TGF-beta signaling during renal tubular epithelial to mesenchymal cell transition.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17591695 2007 Arkadia activates Smad3/Smad4-dependent transcription by triggering signal-induced SnoN degradation.
17510063 2007 Arkadia induces degradation of SnoN and c-Ski to enhance transforming growth factor-beta signaling.
16601693 2006 Axin is a scaffold protein in TGF-beta signaling that promotes degradation of Smad7 by Arkadia.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14657019 2003 Arkadia amplifies TGF-beta superfamily signalling through degradation of Smad7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11516970 2001 Vertebrate development: Et in Arkadia.
11298453 2001 Arkadia enhances nodal-related signalling to induce mesendoderm.
11298452 2001 Induction of the mammalian node requires Arkadia function in the extraembryonic lineages.