Property Summary

NCBI Gene PubMed Count 17
PubMed Score 142.98
PubTator Score 11.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
osteosarcoma -2.034 2.7e-04
posterior fossa group A ependymoma 1.300 2.3e-06
glioblastoma 2.100 3.1e-06
group 3 medulloblastoma 2.800 3.1e-07
atypical teratoid / rhabdoid tumor 2.200 3.7e-09
medulloblastoma, large-cell 3.000 2.2e-07
primitive neuroectodermal tumor 2.400 5.0e-06
adrenocortical carcinoma 1.705 6.1e-07
non-small cell lung cancer 1.873 2.9e-21
colon cancer 1.600 2.1e-03
lung cancer 2.300 1.7e-04
pediatric high grade glioma 1.900 9.2e-08
lung adenocarcinoma 1.100 8.2e-10
psoriasis 1.100 3.4e-13
Endometriosis 1.008 3.4e-02
Breast cancer 1.600 2.9e-14
invasive ductal carcinoma 1.600 3.3e-04
acute myeloid leukemia -1.200 1.7e-02
ovarian cancer 1.300 1.5e-03

Gene RIF (4)

PMID Text
25703292 Studies indicate that most antiviral-defense systems involve RNase H-like enzymes destroying invading nucleic acids, RNA, or DNA.
24986920 RNase H2 complex is assembled in the cytosol and imported into the nucleus in an RNase H2B-dependent manner.
23592335 study identified two synonymous variants in RNASEH2A that result in loss of RNase H2 enzyme function and the consequent Aicardi-Goutieres syndrome phenotype
21454563 analysis of the RNase H2A subunit mutations that cause Aicardi-Goutieres syndrome

AA Sequence

MDLSELERDNTGRCRLSSPVPAVCRKEPCVLGVDEAGRGPVLGPMVYAICYCPLPRLADLEALKVADSKT      1 - 70
LLESERERLFAKMEDTDFVGWALDVLSPNLISTSMLGRVKYNLNSLSHDTATGLIQYALDQGVNVTQVFV     71 - 140
DTVGMPETYQARLQQSFPGIEVTVKAKADALYPVVSAASICAKVARDQAVKKWQFVEKLQDLDTDYGSGY    141 - 210
PNDPKTKAWLKEHVEPVFGFPQFVRFSWRTAQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQAR    211 - 280
PRSSHRYFLERGLESATSL                                                       281 - 299
//

Text Mined References (21)

PMID Year Title
25703292 2015 The reverse transcriptase-RNase H: from viruses to antiviral defense.
24986920 2014 Altered spatio-temporal dynamics of RNase H2 complex assembly at replication and repair sites in Aicardi-Goutières syndrome.
23603115 2013 Ribonucleotides misincorporated into DNA act as strand-discrimination signals in eukaryotic mismatch repair.
23592335 2013 Synonymous mutations in RNASEH2A create cryptic splice sites impairing RNase H2 enzyme function in Aicardi-Goutières syndrome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21454563 2011 Functional consequences of the RNase H2A subunit mutations that cause Aicardi-Goutieres syndrome.
21269460 2011 Initial characterization of the human central proteome.
21177858 2011 The structural and biochemical characterization of human RNase H2 complex reveals the molecular basis for substrate recognition and Aicardi-Goutières syndrome defects.
20131292 2010 Expanding the phenotypic spectrum of lupus erythematosus in Aicardi-Goutières syndrome.
19139135 2009 Genomics screen in transformed stem cells reveals RNASEH2A, PPAP2C, and ADARB1 as putative anticancer drug targets.
19015152 2009 Contributions of the two accessory subunits, RNASEH2B and RNASEH2C, to the activity and properties of the human RNase H2 complex.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17846997 2007 Clinical and molecular phenotype of Aicardi-Goutieres syndrome.
16845400 2006 Mutations in genes encoding ribonuclease H2 subunits cause Aicardi-Goutières syndrome and mimic congenital viral brain infection.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9789007 1998 Cloning of the cDNA encoding the large subunit of human RNase HI, a homologue of the prokaryotic RNase HII.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.