Property Summary

Ligand Count 2
NCBI Gene PubMed Count 60
PubMed Score 328.08
PubTator Score 299.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.800 4.0e-04
Astrocytoma, Pilocytic 2.000 1.8e-07
colon cancer -1.900 1.7e-02
ependymoma 1.300 4.1e-04
gastric cancer -1.200 1.0e-03
glioblastoma 1.300 1.2e-03
group 3 medulloblastoma -1.300 5.2e-03
interstitial cystitis 1.100 3.6e-02
osteosarcoma -7.371 1.6e-08
psoriasis 1.600 1.1e-15
tuberculosis 3.100 5.2e-07
Waldenstrons macroglobulinemia 4.362 1.3e-03

PDB (12)

Gene RIF (30)

AA Sequence

MVPKLFTSQICLLLLLGLLAVEGSLHVKPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTF      1 - 70
LLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDN     71 - 140
RDQRRDPPQYPVVPVHLDRII                                                     141 - 161
//

Text Mined References (64)

PMID Year Title