Property Summary

NCBI Gene PubMed Count 58
PubMed Score 313.39
PubTator Score 299.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
gastric cancer -1.200 1.0e-03
Waldenstrons macroglobulinemia 4.362 1.3e-03
osteosarcoma -7.371 1.6e-08
posterior fossa group A ependymoma 1.700 1.9e-05
glioblastoma 2.400 1.4e-03
tuberculosis 3.100 5.2e-07
colon cancer -2.100 3.9e-05
interstitial cystitis 1.100 3.6e-02
adult high grade glioma 1.800 4.0e-04
group 3 medulloblastoma -1.300 5.2e-03
pilocytic astrocytoma 2.000 1.5e-07
psoriasis 1.600 1.1e-15

Gene RIF (29)

PMID Text
26534742 Serum EDN level may be a useful marker for monitoring persistent airflow limitation in adult patients with asthma who had positive results for house-dust-specific IgE antibodies.
25221852 RNASE2 gene expression was differentially expressed in rheumatoid arthritis patients considering a sequence polymorphism.
24890227 increased in feces after the ingestion of enterocolitis-causative foods
24814827 mRNA levels of eosinophil granule proteins, rather than sputum eosinophil%, may reflect airway hyperresponsiveness and airflow limitation.
23533305 A higher level of serum EDN was found specifically in patients with ALS, indicating that EDN may participate in the pathophysiology of Amyotrophic lateral sclerosis.
23053729 findings show substantial amounts of EPX/EDN localise in an extra-granular, low equilibrium density compartment of eosinophils
21680952 Eosinophil protein X in urine from asymptomatic neonates is a biomarker significantly associated with later development of allergic sensitization, nasal eosinophilia, and eczema during the first 6 years of life
19717523 ECP and EDN disrupt skin integrity and cause inflammation
19115260 the roles of the six discrete segments in transcription regulation were investigated and the -350/-329 region (ednR2) was shown to be involved in the regulation of edn expression
19014520 No variation in genes encoding eosinophil-derived neurotoxin for Atopic dermatitis pathogenesis in this German cohort.
19014520 Observational study of gene-disease association. (HuGE Navigator)
18636464 In three continental population groups (Asia, Europe, Africa), the angiogenin and RNase 2 genes appear to exhibit markedly less genetic heterogeneity with regard to T195C and A238G (ANG) and C425A (RNASE2) SNPs.
18636464 Observational study of genotype prevalence. (HuGE Navigator)
18195069 EDN can activate myeloid DCs by triggering the Toll-like receptor (TLR)2-myeloid differentiation factor 88 signaling pathway
17965582 Urinary concentrations of eosinophil-derived neurotoxin in patients with atopic dermatitis show a significant positive correlation with disease severity.
17927842 MAZ and Sp1 play important roles on the transcriptional activation of the human edn promoter through specific binding to a 34-nt segment present in representative primate eosinophil rnase promoters.
17641730 Data show that uEPX/c levels did not correlate with established markers of asthma severity and eosinophilic airway inflammation in atopic asthmatic children.
17351112 EGO is a novel ncRNA gene expressed during eosinophil development and is necessary for normal MBP and EDN transcript expression.
16428483 Elevated glycosylated form of EDN in urine is associated with ovarian cancer
16014847 Observational study of gene-disease association. (HuGE Navigator)
16014847 May possibly be associated with the development of tropical pulmonary eosinophilia.
15755456 Results describe the crystal structure of placental ribonuclease inhibitor in complex with eosinophil-derived neurotoxin, and a mutational analysis based on this structure.
15528350 Results reveal the dendritic cell-activating activity of eosinophil-derived neurotoxin and suggest that it is a likely participant of inflammatory and immune responses--an endogenous multifunctional immune alarmin.
15356558 data suggest that peripheral blood eosinophils from subjects with untreated asthma have increased inflammatory capacity, as reflected by greater intracellular concentrations of EDN
12606041 evidence for glycosylphosphatidylinositol (GPI)-anchored neurotoxin on granulocytes
11959927 EDN and ECP are paralogs in human and Old World monkeys.
11916383 crystal structure of a post-translationally modified form of eosinophil-derived neurotoxin (EDN) with four extra residues on its N terminus ((-4)EDN) has been solved and refined at atomic resolution (1 A)
11876642 atomic resolution structure
9826755 The antimicrobial protein, RNase 2 exhibits antiviral against respiratory syncytial virus.

AA Sequence

MVPKLFTSQICLLLLLGLLAVEGSLHVKPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTF      1 - 70
LLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDN     71 - 140
RDQRRDPPQYPVVPVHLDRII                                                     141 - 161
//

Text Mined References (62)

PMID Year Title
26534742 Serum eosinophil-derived neurotoxin: correlation with persistent airflow limitation in adults with house-dust mite allergic asthma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25221852 2015 Relationship between SNPs and expression level for candidate genes in rheumatoid arthritis.
24890227 2014 Elevation of fecal eosinophil-derived neurotoxin in infants with food protein-induced enterocolitis syndrome.
24814827 2014 Expression levels of eosinophil granule protein mRNAs in induced sputum reflect airway hyperresponsiveness and airflow limitation.
24337645 2014 Comparative genomic analysis of eutherian ribonuclease A genes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23533305 2013 Eosinophil-derived neurotoxin is elevated in patients with amyotrophic lateral sclerosis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23053729 2013 An extragranular compartment of blood eosinophils contains eosinophil protein X/eosinophil-derived neurotoxin (EPX/EDN).
21680952 2011 Elevated eosinophil protein X in urine from healthy neonates precedes development of atopy in the first 6 years of life.
21666788 2011 Effects of chronic ascariasis and trichuriasis on cytokine production and gene expression in human blood: a cross-sectional study.
20570966 2010 Fucosyltransferase 2 (FUT2) non-secretor status is associated with Crohn's disease.
19717523 2009 Eosinophil ribonucleases and their cutaneous lesion-forming activity.
19115260 2009 Transcriptional regulation of human eosinophil RNase2 by the liver-enriched hepatocyte nuclear factor 4.
19014520 2008 Variation in genes encoding eosinophil granule proteins in atopic dermatitis patients from Germany.
18694936 2008 Post-translational tyrosine nitration of eosinophil granule toxins mediated by eosinophil peroxidase.
18636464 2008 Three single nucleotide polymorphisms leading to non-synonymous amino acid substitution in the human ribonuclease 2 and angiogenin genes exhibit markedly less genetic heterogeneity in six populations.
18195069 2008 Eosinophil-derived neurotoxin acts as an alarmin to activate the TLR2-MyD88 signal pathway in dendritic cells and enhances Th2 immune responses.
17965582 2007 Urinary eosinophil-derived neurotoxin concentrations in patients with atopic dermatitis: a useful clinical marker for disease activity.
17927842 2007 Transcriptional regulation of human eosinophil RNases by an evolutionary- conserved sequence motif in primate genome.
17641730 2007 Urinary eosinophil protein X in children with atopic asthma.
17351112 2007 EGO, a novel, noncoding RNA gene, regulates eosinophil granule protein transcript expression.
16428483 2006 Proteomic-based discovery and characterization of glycosylated eosinophil-derived neurotoxin and COOH-terminal osteopontin fragments for ovarian cancer in urine.
16401072 2006 Crystal structures of eosinophil-derived neurotoxin (EDN) in complex with the inhibitors 5'-ATP, Ap3A, Ap4A, and Ap5A.
16014847 2005 Genetic polymorphisms of eosinophil-derived neurotoxin and eosinophil cationic protein in tropical pulmonary eosinophilia.
15755456 2005 Molecular recognition of human eosinophil-derived neurotoxin (RNase 2) by placental ribonuclease inhibitor.
15528350 2004 Human ribonuclease A superfamily members, eosinophil-derived neurotoxin and pancreatic ribonuclease, induce dendritic cell maturation and activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15356558 2004 Peripheral blood eosinophils from patients with allergic asthma contain increased intracellular eosinophil-derived neurotoxin.
12855582 2003 Eosinophil-derived neurotoxin (EDN), an antimicrobial protein with chemotactic activities for dendritic cells.
12606041 2003 Evidence for glycosylphosphatidylinositol (GPI)-anchored eosinophil-derived neurotoxin (EDN) on human granulocytes.
12578357 2003 Mutational analysis of the complex of human RNase inhibitor and human eosinophil-derived neurotoxin (RNase 2).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11959927 2002 The past as the key to the present: resurrection of ancient proteins from eosinophils.
11916383 2002 Crystallographic and functional studies of a modified form of eosinophil-derived neurotoxin (EDN) with novel biological activities.
11876642 2002 Atomic resolution (0.98 A) structure of eosinophil-derived neurotoxin.
11311552 2001 Gene structure and enzymatic activity of mouse eosinophil-associated ribonuclease 2.
11282395 2000 Normal V(D)J recombination in cells from patients with Nijmegen breakage syndrome.
11154698 2001 Mapping the ribonucleolytic active site of eosinophil-derived neurotoxin (EDN). High resolution crystal structures of EDN complexes with adenylic nucleotide inhibitors.
11102386 2000 Sequence variation at two eosinophil-associated ribonuclease loci in humans.
10741866 1999 Eosinophils, ribonucleases and host defense: solving the puzzle.
9826755 1998 Evolution of antiviral activity in the ribonuclease A gene superfamily: evidence for a specific interaction between eosinophil-derived neurotoxin (EDN/RNase 2) and respiratory syncytial virus.
9620664 1998 Localization of eosinophil-derived neurotoxin and eosinophil cationic protein in neutrophilic leukocytes.
9450956 1998 Recognition signal for C-mannosylation of Trp-7 in RNase 2 consists of sequence Trp-x-x-Trp.
8759319 1996 X-ray crystallographic structure of recombinant eosinophil-derived neurotoxin at 1.83 A resolution.
8471426 1993 Characterisation of UGP and its relationship with beta-core fragment.
7947762 1994 New type of linkage between a carbohydrate and a protein: C-glycosylation of a specific tryptophan residue in human RNase Us.
7547911 1995 The hexopyranosyl residue that is C-glycosidically linked to the side chain of tryptophan-7 in human RNase Us is alpha-mannopyranose.
3926759 1985 Purification and properties of bovine kidney ribonucleases.
3458170 1986 Biochemical and functional similarities between human eosinophil-derived neurotoxin and eosinophil cationic protein: homology with ribonuclease.
3182786 1988 Purification and characterization of a ribonuclease from human liver.
3166997 1988 Amino acid sequence of the nonsecretory ribonuclease of human urine.
2745977 1989 Eosinophil cationic protein cDNA. Comparison with other toxic cationic proteins and ribonucleases.
2734298 1989 Molecular cloning of the human eosinophil-derived neurotoxin: a member of the ribonuclease gene family.
2591744 1989 Sequence of human eosinophil-derived neurotoxin cDNA: identity of deduced amino acid sequence with human nonsecretory ribonucleases.
2387583 1990 Structure and chromosome localization of the human eosinophil-derived neurotoxin and eosinophil cationic protein genes: evidence for intronless coding sequences in the ribonuclease gene superfamily.
1587793 1992 Characterization of a unique nonsecretory ribonuclease from urine of pregnant women.
1577491 1992 Localization of the human eosinophil Charcot-Leyden crystal protein (lysophospholipase) gene (CLC) to chromosome 19 and the human ribonuclease 2 (eosinophil-derived neurotoxin) and ribonuclease 3 (eosinophil cationic protein) genes (RNS2 and RNS3) to chromosome 14.
1464733 1992 Eosinophil granule proteins in peripheral blood granulocytes.