Property Summary

NCBI Gene PubMed Count 11
PubMed Score 39.53
PubTator Score 7.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma 1.200 2.7e-06
astrocytic glioma -1.500 4.5e-02
psoriasis -1.300 1.6e-03
osteosarcoma -1.328 6.1e-03
posterior fossa group A ependymoma -1.200 9.8e-07
glioblastoma -1.600 1.3e-05
atypical teratoid / rhabdoid tumor -1.600 3.4e-05
medulloblastoma, large-cell 1.200 7.8e-04
ulcerative colitis -1.527 3.4e-02
hereditary spastic paraplegia -1.145 1.7e-02
non-small cell lung cancer 1.075 1.2e-12
lung cancer 1.500 1.1e-04
adult high grade glioma -1.400 5.5e-04
pilocytic astrocytoma -1.600 3.6e-06
subependymal giant cell astrocytoma -2.125 7.9e-03
spina bifida -1.582 2.2e-02
ovarian cancer -1.200 5.5e-04

Synonym

Accession Q9H871 D6W5M6 Q6NTF0 Q9H6W5 Q9H9H2
Symbols CTLH
GID2
RMD5
GID2A
p44CTLH

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
24057215 The study identifies a miR-138-RMND5A-Exportin-5 as a previously unknown miRNA processing regulatory pathway in HeLa cells.
22681319 Duplications of this region involving RMND5A, whose product contains a C-terminal to lis homology (LisH) domain, have not previously been associated with a defined phenotype but may present insight into encephalocele formation.
17467196 RanBPM, ARMC8alpha, ARMC8beta, Muskelin, p48EMLP, and p44CTLH form complexes in cells.

AA Sequence

MDQCVTVERELEKVLHKFSGYGQLCERGLEELIDYTGGLKHEILQSHGQDAELSGTLSLVLTQCCKRIKD      1 - 70
TVQKLASDHKDIHSSVSRVGKAIDKNFDSDISSVGIDGCWQADSQRLLNEVMVEHFFRQGMLDVAEELCQ     71 - 140
ESGLSVDPSQKEPFVELNRILEALKVRVLRPALEWAVSNREMLIAQNSSLEFKLHRLYFISLLMGGTTNQ    141 - 210
REALQYAKNFQPFALNHQKDIQVLMGSLVYLRQGIENSPYVHLLDANQWADICDIFTRDACALLGLSVES    211 - 280
PLSVSFSAGCVALPALINIKAVIEQRQCTGVWNQKDELPIEVDLGKKCWYHSIFACPILRQQTTDNNPPM    281 - 350
KLVCGHIISRDALNKMFNGSKLKCPYCPMEQSPGDAKQIFF                                 351 - 391
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24057215 2014 MiR-138 downregulates miRNA processing in HeLa cells by targeting RMND5A and decreasing Exportin-5 stability.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681319 2012 Novel neurodevelopmental disorder in the case of a giant occipitoparietal meningoencephalocele.
17467196 2007 RanBPM, Muskelin, p48EMLP, p44CTLH, and the armadillo-repeat proteins ARMC8alpha and ARMC8beta are components of the CTLH complex.
17452337 2007 ELMOD2 is an Arl2 GTPase-activating protein that also acts on Arfs.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.