Property Summary

NCBI Gene PubMed Count 12
PubMed Score 42.01
PubTator Score 7.39

Knowledge Summary


No data available


  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.400 5.5e-04
astrocytic glioma -1.500 4.5e-02
Astrocytoma, Pilocytic -1.600 3.6e-06
atypical teratoid / rhabdoid tumor -1.600 3.4e-05
ependymoma -1.100 3.2e-06
glioblastoma -1.100 2.7e-06
hereditary spastic paraplegia -1.145 1.7e-02
lung cancer 1.400 2.3e-02
malignant mesothelioma 1.200 2.7e-06
medulloblastoma, large-cell 1.200 7.8e-04
non-small cell lung cancer 1.075 1.2e-12
osteosarcoma -1.328 6.1e-03
ovarian cancer -1.200 5.5e-04
psoriasis 1.100 1.2e-03
spina bifida -1.582 2.2e-02
subependymal giant cell astrocytoma -1.206 2.4e-02
ulcerative colitis -1.527 3.4e-02

Gene RIF (3)

AA Sequence

KLVCGHIISRDALNKMFNGSKLKCPYCPMEQSPGDAKQIFF                                 351 - 391

Text Mined References (13)

PMID Year Title