Property Summary

NCBI Gene PubMed Count 33
PubMed Score 50.65
PubTator Score 34.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Melanoma 261
Disease Target Count Z-score Confidence
Orotic aciduria 16 3.676 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.300 3.7e-04
osteosarcoma -1.724 1.0e-09
group 4 medulloblastoma -1.400 4.3e-06
medulloblastoma, large-cell -1.700 6.8e-06
non primary Sjogren syndrome sicca 1.100 1.9e-02

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
588664 screening 1435 / 0 / 358049 TRFRET-based biochemical primary high throughput screening assay to identify inhibitors of the interaction of the Ras and Rab interactor 1 protein (Rin1) and the c-abl oncogene 1, non-receptor tyrosine kinase (Abl)
588669 summary 0 / 0 / 0 Summary of the probe development efforts to identify inhibitors of the interaction of the Ras and Rab interactor 1 protein (Rin1) and the c-abl oncogene 1, non-receptor tyrosine kinase (Abl)
602124 screening 630 / 0 / 667 TRFRET-based biochemical high throughput confirmation assay for inhibitors of the interaction of the Ras and Rab interactor 1 protein (Rin1) and the c-abl oncogene 1, non-receptor tyrosine kinase (Abl)
602181 confirmatory 82 / 0 / 148 TRFRET-based biochemical high throughput dose response assay for inhibitors of the interaction of the Ras and Rab interactor 1 protein (Rin1) and the c-abl oncogene 1, non-receptor tyrosine kinase (Abl)
624124 confirmatory 4 / 0 / 0 Late stage assay for the probe development effort to identify inhibitors of the interaction of the Ras and Rab interactor 1 protein (Rin1) and the c-abl oncogene 1, non-receptor tyrosine kinase (Abl): TRFRET-based biochemical dose response assay for inhibitors of Rin1-Abl interactions (ROUND 1)
624303 other 0 / 0 / 26 Late stage assay provider assay for the probe development effort to identify inhibitors of the interaction of the Ras and Rab interactor 1 protein (Rin1) and the c-abl oncogene 1, non-receptor tyrosine kinase (Abl): Chemiluminescence-based biochemical kinase assay to identify inhibitors of Abl-mediated phosphorylation of purified CRK (powders ROUND 1)
686966 confirmatory 3 / 0 / 7 Late stage assay for the probe development effort to identify inhibitors of the interaction of the Ras and Rab interactor 1 protein (Rin1) and the c-abl oncogene 1, non-receptor tyrosine kinase (Abl): TRFRET-based biochemical dose response assay for inhibitors of Rin1-Abl interactions (ROUND 2)

Gene RIF (15)

PMID Text
22976291 Findings suggest that RIN1 orchestrates RAB5 activation, ABL kinase activation and BIN1 recruitment to determine EGFR fate.
22627834 RIN1 expression could be a potential prognostic predictor for the melanoma patients and provide a potential target therapy for melanoma treatment.
22562267 RIN1 plays an important role in gastric adenocarcinoma progression and that a high RIN1 expression predicts an unfavorable prognosis in gastric adenocarcinoma patients.
22249975 RIN1 expression could be a potential prognostic predictor for bladder urothelial carcinoma (UC) patients.
21925717 over-expression of RIN1 may play an important role in the progression of non-small cell lung cancer and RIN1 expression may offer a valuable marker for predicting the outcome of patients with NSCLC
21209314 These data identify a novel PKD signaling pathway through RIN1 and Abl kinases that is involved in the regulation of actin remodeling and cell migration.
21102429 BCR-ABL1 kinase activity is regulated by RIN1
19806790 the novel RIN1 mRNA was found to be expressed in gastric and colon cancer cell lines, suggesting that it is an important gene for the function of cancer cells.
19570984 Data demonstrate that proper internalization and endocytic trafficking are critical for EGFR-mediated signaling in A549 cells and suggest that up-regulation of Rin1 in A549 cell lines may contribute to their proliferative nature.
19118546 Mutations in the Vps9 domain of Rin1 lead to a loss-of-function phenotype, indicating a specific structure-function relationship between Rab5 and Rin1.
19032933 Specific residues of RIN1 are required for its interaction with Rab5, binding to the endosomal membranes and subsequent regulation of the fusion reaction.
18089779 In a tumor cell line, RIN1 silencing may contribute to breast cancer progression.
17403676 Rin1 regulates EGFR degradation in cooperation with STAM
17390061 These results indicate that the RIN1 gene serves as an important signal transduction system for evaluating the malignancy of colorectal cancer.
16457816 Plays an important role in both insulin receptor membrane trafficking and signaling.

AA Sequence

MESPGESGAGSPGAPSPSSFTTGHLAREKPAQDPLYDVPNASGGQAGGPQRPGRVVSLRERLLLTRPVWL      1 - 70
QLQANAAAALHMLRTEPPGTFLVRKSNTRQCQALCMRLPEASGPSFVSSHYILESPGGVSLEGSELMFPD     71 - 140
LVQLICAYCHTRDILLLPLQLPRAIHHAATHKELEAISHLGIEFWSSSLNIKAQRGPAGGPVLPQLKARS    141 - 210
PQELDQGTGAALCFFNPLFPGDLGPTKREKFKRSFKVRVSTETSSPLSPPAVPPPPVPVLPGAVPSQTER    211 - 280
LPPCQLLRRESSVGYRVPAGSGPSLPPMPSLQEVDCGSPSSSEEEGVPGSRGSPATSPHLGRRRPLLRSM    281 - 350
SAAFCSLLAPERQVGRAAAALMQDRHTAAGQLVQDLLTQVRAGPEPQELQGIRQALSRARAMLSAELGPE    351 - 420
KLLSPKRLEHVLEKSLHCSVLKPLRPILAARLRRRLAADGSLGRLAEGLRLARAQGPGAFGSHLSLPSPV    421 - 490
ELEQVRQKLLQLLRTYSPSAQVKRLLQACKLLYMALRTQEGEGAGADEFLPLLSLVLAHCDLPELLLEAE    491 - 560
YMSELLEPSLLTGEGGYYLTSLSASLALLSGLGQAHTLPLSPVQELRRSLSLWEQRRLPATHCFQHLLRV    561 - 630
AYQDPSSGCTSKTLAVPPEASIATLNQLCATKFRVTQPNTFGLFLYKEQGYHRLPPGALAHRLPTTGYLV    631 - 700
YRRAEWPETQGAVTEEEGSGQSEARSRGEEQGCQGDGDAGVKASPRDIREQSETTAEGGQGQAQEGPAQP    701 - 770
GEPEAEGSRAAEE                                                             771 - 783
//

Text Mined References (37)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22976291 2012 RIN1 orchestrates the activation of RAB5 GTPases and ABL tyrosine kinases to determine the fate of EGFR.
22627834 2012 RIN1 exhibits oncogenic property to suppress apoptosis and its aberrant accumulation associates with poor prognosis in melanoma.
22562267 2012 High RIN1 expression is associated with poor prognosis in patients with gastric adenocarcinoma.
22249975 2012 Overexpression of RIN1 associates with tumor grade and progression in patients of bladder urothelial carcinoma.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21925717 2012 Prognostic significance of RIN1 gene expression in human non-small cell lung cancer.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21209314 2011 A novel protein kinase D phosphorylation site in the tumor suppressor Rab interactor 1 is critical for coordination of cell migration.
21102429 2011 ABL fusion oncogene transformation and inhibitor sensitivity are mediated by the cellular regulator RIN1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19806790 2009 Cloning of a novel splicing variant of RIN1 and its expression in gastric and colon cancer.
19570984 2009 Cell proliferation and epidermal growth factor signaling in non-small cell lung adenocarcinoma cell lines are dependent on Rin1.
19118546 2009 Functional determinants of ras interference 1 mutants required for their inhbitory activity on endocytosis.
19032933 2009 Inhibition of early endosome fusion by Rab5-binding defective Ras interference 1 mutants.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18089779 2007 RIN1 is a breast tumor suppressor gene.
17403676 2007 Rin1 interacts with signal-transducing adaptor molecule (STAM) and mediates epidermal growth factor receptor trafficking and degradation.
17390061 2007 Analysis of RIN1 gene expression in colorectal cancer.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16457816 2006 Rin1 regulates insulin receptor signal transduction pathways.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15886098 2005 RIN1 is an ABL tyrosine kinase activator and a regulator of epithelial-cell adhesion and migration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12574403 2003 The RAS effector RIN1 modulates the formation of aversive memories.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11788587 2002 Involvement of phosphatidylinositol 3-kinase, but not RalGDS, in TC21/R-Ras2-mediated transformation.
11784866 2002 The RAS effector RIN1 directly competes with RAF and is regulated by 14-3-3 proteins.
11703925 2001 Ras-activated endocytosis is mediated by the Rab5 guanine nucleotide exchange activity of RIN1.
9208849 1997 Regulation of the oncogenic activity of BCR-ABL by a tightly bound substrate protein RIN1.
9144171 1997 Protein binding and signaling properties of RIN1 suggest a unique effector function.
7862125 1995 A human protein selected for interference with Ras function interacts directly with Ras and competes with Raf1.
3874369 1985 Thymocyte subpopulation enriched for progenitors with an unrearranged T-cell receptor beta-chain gene.
1849280 1991 Expression of three mammalian cDNAs that interfere with RAS function in Saccharomyces cerevisiae.