Property Summary

NCBI Gene PubMed Count 29
PubMed Score 42.66
PubTator Score 20.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -2.200 2.6e-07
astrocytic glioma -1.300 1.2e-03
Astrocytoma, Pilocytic -1.900 6.1e-11
atypical teratoid / rhabdoid tumor -2.400 2.1e-07
ependymoma -1.700 1.3e-03
glioblastoma -2.200 3.0e-11
group 4 medulloblastoma -1.500 1.6e-05
interstitial cystitis -1.600 2.3e-02
lung carcinoma 4.600 2.9e-56
malignant mesothelioma 3.500 1.3e-08
medulloblastoma, large-cell -1.200 4.5e-03
oligodendroglioma -1.800 1.3e-08
osteosarcoma 1.243 7.2e-04
Pick disease -1.200 1.4e-02
primitive neuroectodermal tumor -2.000 3.4e-04
subependymal giant cell astrocytoma -3.165 2.6e-02

Gene RIF (7)

AA Sequence

MSAPVGPRGRLAPIPAASQPPLQPEMPDLSHLTEEERKIILAVMDRQKKKVKEEHKPQLTQWFPFSGITE      1 - 70
LVNNVLQPQQKQQNEKEPQTKLHQQFEMYKEQVKKMGEESQQQQEQKGDAPTCGICHKTKFADGCGHNCS     71 - 140
YCQTKFCARCGGRVSLRSNKVMWVCNLCRKQQEILTKSGAWFYNSGSNTPQQPDQKVLRGLRNEEAPQEK    141 - 210
KPKLHEQTQFQGPSGDLSVPAVEKSRSHGLTRQHSIKNGSGVKHHIASDIASDRKRSPSVSRDQNRRYDQ    211 - 280
REEREEYSQYATSDTAMPRSPSDYADRRSQHEPQFYEDSDHLSYRDSNRRSHRHSKEYIVDDEDVESRDE    281 - 350
YERQRREEEYQSRYRSDPNLARYPVKPQPYEEQMRIHAEVSRARHERRHSDVSLANADLEDSRISMLRMD    351 - 420
RPSRQRSISERRAAMENQRSYSMERTREAQGPSSYAQRTTNHSPPTPRRSPLPIDRPDLRRTDSLRKQHH    421 - 490
LDPSSAVRKTKREKMETMLRNDSLSSDQSESVRPPPPKPHKSKKGGKMRQISLSSSEEELASTPEYTSCD    491 - 560
DVEIESESVSEKGDSQKGKRKTSEQAVLSDSNTRSERQKEMMYFGGHSLEEDLEWSEPQIKDSGVDTCSS    561 - 630
TTLNEEHSHSDKHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSGAMLGLKVVGGKMTESGRLCAFITK    631 - 700
VKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQL    701 - 770
ESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWFDKVGHQLIVTILGAKDLPSREDGRP    771 - 840
RNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLG    841 - 910
EILIELETALLDDEPHWYKLQTHDVSSLPLPHPSPYMPRRQLHGESPTRRLQRSKRISDSEVSDYDCDDG    911 - 980
IGVVSDYRHDGRDLQSSTLSVPEQVMSSNHCSPSGSPHRVDVIGRTRSWSPSVPPPQSRNVEQGLRGTRT    981 - 1050
MTGHYNTISRMDRHRVMDDHYSPDRDRDCEAADRQPYHRSRSTEQRPLLERTTTRSRSTERPDTNLMRSM   1051 - 1120
PSLMTGRSAPPSPALSRSHPRTGSVQTSPSSTPVAGRRGRQLPQLPPKGTLDRKAGGKKLRSTVQRSTET   1121 - 1190
GLAVEMRNWMTRQASRESTDGSMNSYSSEGNLIFPGVRLASDSQFSDFLDGLGPAQLVGRQTLATPAMGD   1191 - 1260
IQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKVARKTLEPLYQQLLSFE   1261 - 1330
ESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLFPPSSLVDPTLAPLTRRASQSSL   1331 - 1400
ESSTGPSYSRS                                                              1401 - 1411
//

Text Mined References (33)

PMID Year Title