Property Summary

NCBI Gene PubMed Count 34
PubMed Score 10.98
PubTator Score 40.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
breast carcinoma 1614 6.6e-04
fibroadenoma 557 2.0e-02

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma -1.300 6.6e-04
fibroadenoma -1.500 2.0e-02

Gene RIF (19)

PMID Text
26469971 RILP suppresses the invasion of breast cancer cells by interacting with RalGDS to inhibit its guanine nucleotide exchange factor activity for RalA.
26180254 RILP regulates vacuolar ATPase through interaction with the V1G1 subunit
25445562 VPS41 subunit of HOPS complex was defined to be the major partner for interacting with RILP.
24762812 RILP regulates the activity of the V-ATPase through its interaction with V1G1.
23729732 RILP directly and concomitantly binds the tethering HOPS complex and the p150(Glued) subunit of the dynein motor. ORP1L then functions as a cholesterol-sensing switch controlling RILP-HOPS-p150(Glued) interactions.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20012524 Rab7 and RILP direct endosome-associated HIV-1 Gag towards the microtubule-organizing center (MTOC)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19564404 Results describe how ORP1L contacts VAP to control Rab7-RILP-p150 Glued and late endosome positioning.
19286658 Rab7 and RILP direct endosome-associated HIV-1 Gag towards the microtubule-organizing center (MTOC)
18922795 REST/NRSF, dynactin p150(Glued), huntingtin, HAP1, and RILP form a complex involved in the translocation of REST/NRSF into the nucleus and HAP1 controls REST/NRSF cellular localization in neurons
17959629 These results establish that RILP is required for biogenesis of multivesicular endosomes and degradative trafficking of EGFRs but not for trafficking of transferrin receptors through early endosomes.
16857164 we have isolated, using the yeast two-hybrid system, the EAP30/SNF8/VPS22 subunit of the ESCRT-II complex as a RILP interacting protein.
16631113 Hence, RILPsv provides an extra dimension to the control of vesicle fusion and transport by the small GTPase Rab7.
16417580 RILP indeed prenylated, while phosphorylation analysis showed that the two protein kinase A sites are phosphorylated.
15996637 The data together indicate that RILP, as already demonstrated for several other Rab effector proteins, is capable of self-association, thus probably forming a homo-dimer.
15933719 The crystal structure of Rab7-GTP in complex with the Rab7 binding domain of RILP reveals that Rab7 interacts with RILP specifically via two distinct areas.
14668488 Unique region in RILP responsible for its specific role in regulating lysosomal morphology as well as in its interaction with Rab7 and Rab34.

AA Sequence

MEPRRAAPGVPGWGSREAAGSASAAELVYHLAGALGTELQDLARRFGPEAAAGLVPLVVRALELLEQAAV      1 - 70
GPAPDSLQVSAQPAEQELRRLREENERLRRELRAGPQEERALLRQLKEVTDRQRDELRAHNRDLRQRGQE     71 - 140
TEALQEQLQRLLLVNAELRHKLAAMQTQLRAAQDRERERQQPGEAATPQAKERARGQAGRPGHQHGQEPE    141 - 210
WATAGAGAPGNPEDPAEAAQQLGRPSEAGQCRFSREEFEQILQERNELKAKVFLLKEELAYFQRELLTDH    211 - 280
RVPGLLLEAMKVAVRKQRKKIKAKMLGTPEEAESSEDEAGPWILLSDDKGDHPPPPESKIQSFFGLWYRG    281 - 350
KAESSEDETSSPAPSKLGGEEEAQPQSPAPDPPCSALHEHLCLGASAAPEA                       351 - 401
//

Text Mined References (37)

PMID Year Title
26911690 2016 Parkin Modulates Endosomal Organization and Function of the Endo-Lysosomal Pathway.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26469971 2015 RILP suppresses invasion of breast cancer cells by modulating the activity of RalA through interaction with RalGDS.
26180254 2015 RILP regulates vacuolar ATPase through interaction with the V1G1 subunit.
25445562 2014 RILP interacts with HOPS complex via VPS41 subunit to regulate endocytic trafficking.
25272277 2014 A Ras-like domain in the light intermediate chain bridges the dynein motor to a cargo-binding region.
24762812 2014 RILP regulates vacuolar ATPase through interaction with the V1G1 subunit.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23729732 2013 Late endosomal transport and tethering are coupled processes controlled by RILP and the cholesterol sensor ORP1L.
22431521 2012 The role of ceroid lipofuscinosis neuronal protein 5 (CLN5) in endosomal sorting.
22261744 2012 Neuronal ceroid lipofuscinosis protein CLN3 interacts with motor proteins and modifies location of late endosomal compartments.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19564404 2009 Cholesterol sensor ORP1L contacts the ER protein VAP to control Rab7-RILP-p150 Glued and late endosome positioning.
18922795 2008 Huntingtin regulates RE1-silencing transcription factor/neuron-restrictive silencer factor (REST/NRSF) nuclear trafficking indirectly through a complex with REST/NRSF-interacting LIM domain protein (RILP) and dynactin p150 Glued.
18787122 2008 The Salmonella virulence protein SifA is a G protein antagonist.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18272684 2008 Functional characterization of Rab7 mutant proteins associated with Charcot-Marie-Tooth type 2B disease.
17959629 2007 RILP is required for the proper morphology and function of late endosomes.
17010938 2006 RILP interacts with VPS22 and VPS36 of ESCRT-II and regulates their membrane recruitment.
16857164 2006 RILP interacts with the VPS22 component of the ESCRT-II complex.
16631113 2006 A splice variant of RILP induces lysosomal clustering independent of dynein recruitment.
16417580 2006 Characterization of the REST/NRSF-interacting LIM domain protein (RILP): localization and interaction with REST/NRSF.
15996637 2005 The Rab-interacting lysosomal protein, a Rab7 and Rab34 effector, is capable of self-interaction.
15933719 2005 Structural basis for recruitment of RILP by small GTPase Rab7.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14668488 2004 A unique region of RILP distinguishes it from its related proteins in its regulation of lysosomal morphology and interaction with Rab7 and Rab34.
12944476 2003 Phagosomes fuse with late endosomes and/or lysosomes by extension of membrane protrusions along microtubules: role of Rab7 and RILP.
12621583 2003 Refinement of a 400-kb critical region allows genotypic differentiation between isolated lissencephaly, Miller-Dieker syndrome, and other phenotypes secondary to deletions of 17p13.3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475955 2002 Interorganellar regulation of lysosome positioning by the Golgi apparatus through Rab34 interaction with Rab-interacting lysosomal protein.
11696325 2001 The Rab7 effector protein RILP controls lysosomal transport by inducing the recruitment of dynein-dynactin motors.
11520070 2001 Expression analysis and chromosomal assignment of PRA1 and RILP genes.
11179213 2001 Rab-interacting lysosomal protein (RILP): the Rab7 effector required for transport to lysosomes.