Property Summary

NCBI Gene PubMed Count 21
PubMed Score 52.80
PubTator Score 31.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia -1.900 4.0e-03
adult high grade glioma -1.600 2.1e-05
aldosterone-producing adenoma -1.289 1.4e-02
Astrocytoma, Pilocytic -1.100 1.4e-03
atypical teratoid / rhabdoid tumor -1.300 1.8e-04
glioblastoma -1.100 1.9e-02
group 4 medulloblastoma -2.400 4.6e-07
medulloblastoma, large-cell -1.800 8.9e-06
nephrosclerosis -1.784 4.5e-03
osteosarcoma 1.292 2.6e-02
pancreatic ductal adenocarcinoma liver m... -3.213 8.6e-03
Pick disease -1.600 5.6e-04
primitive neuroectodermal tumor -1.200 2.0e-02
progressive supranuclear palsy -1.300 2.3e-02

Gene RIF (3)

AA Sequence

MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAAG      1 - 70
CDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAVAIQGPLTTASL        71 - 137
//

Text Mined References (25)

PMID Year Title