Property Summary

NCBI Gene PubMed Count 10
PubMed Score 34.11
PubTator Score 9.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Mammary Neoplasms 410
Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.3e-15
nasopharyngeal carcinoma 1056 1.7e-09
Disease Target Count Z-score Confidence
Necrotizing fasciitis 9 3.213 1.6
Myelomeningocele 11 3.16 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
posterior fossa group B ependymoma 3.500 1.3e-15
nasopharyngeal carcinoma -1.300 1.7e-09

Synonym

Accession Q9H4K1 Q6ICD0 Q9Y413
Symbols TRIB
C22orf11

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

AA Sequence

MRQNDKIMCILENRKKRDRKNLCRAINDFQQSFQKPETRREFDLSDPLALKKDLPARQSDNDVRNTISGM      1 - 70
QKFMGEDLNFHERKKFQEEQNREWSLQQQREWKNARAEQKCAEALYTETRLQFDETAKHLQKLESTTRKA     71 - 140
VCASVKDFNKSQAIESVERKKQEKKQEQEDNLAEITNLLRGDLLSENPQQAASSFGPHRVVPDRWKGMTQ    141 - 210
EQLEQIRLVQKQQIQEKLRLQEEKRQRDLDWDRRRIQGARATLLFERQQWRRQRDLRRALDSSNLSLAKE    211 - 280
QHLQKKYMNEVYTNQPTGDYFTQFNTGSR                                             281 - 309
//

Text Mined References (11)

PMID Year Title
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
21630459 2011 Proteomic characterization of the human sperm nucleus.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15563848 2004 Genomic structure and expression analysis of the mouse testis-specific ribbon protein (Trib) gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.