Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1492.90
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
osteosarcoma -2.387 4.5e-06
ependymoma 1.200 3.4e-07
glioblastoma 1.300 1.0e-06
group 3 medulloblastoma 2.100 1.7e-05
atypical teratoid/rhabdoid tumor 1.600 2.2e-07
primitive neuroectodermal tumor 1.700 5.2e-05
adrenocortical carcinoma 1.194 6.6e-04
non-small cell lung cancer 1.274 1.4e-16
intraductal papillary-mucinous neoplasm ... 1.100 8.7e-03
pediatric high grade glioma 1.600 2.9e-06
nasopharyngeal carcinoma 1.200 1.8e-03
invasive ductal carcinoma 1.100 5.0e-03
ovarian cancer 1.400 7.2e-05

Synonym

Accession Q9BSD3 B7Z989
Symbols RHINO
C12orf32
HKMT1188

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (12)

Gene RIF (4)

PMID Text
25602520 Knockdown of RHINO in human cells partially abrogated ATR-Chk1 kinase signaling following UV irradiation but did not impact the loading of Rad9-Hus1-Rad1 complex on chromatin or the association of Rad9-Hus1-Rad1 complex with TopBP1.
24562772 Germline variation in the RHINO gene is unlikely to influence inherited susceptibility to breast cancer.
21659603 We suggest that RHINO functions together with the 9-1-1 complex and TopBP1 to fully activate ATR (ataxia telangiectasia and Rad3-related.
20811708 Identified C12orf32 to be significantly up-regulated in the great majority of clinical breast cancer specimens.

AA Sequence

MPPRKKRRQPSQKAPLLFHQQPLEGPKHSCASTQLPITHTRQVPSKPIDHSTITSWVSPDFDTAAGSLFP      1 - 70
AYQKHQNRARHSSRKPTTSKFPHLTFESPQSSSSETLGIPLIRECPSESEKDVSRRPLVPVLSPQSCGNM     71 - 140
SVQALQSLPYVFIPPDIQTPESSSVKEELIPQDQKENSLLSCTLHTGTPNSPEPGPVLVKDTPEDKYGIK    141 - 210
VTWRRRQHLLAYLRERGKLSRSQFLVKS                                              211 - 238
//

Text Mined References (15)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25602520 2015 RHINO forms a stoichiometric complex with the 9-1-1 checkpoint clamp and mediates ATR-Chk1 signaling.
25416956 2014 A proteome-scale map of the human interactome network.
24562772 2014 Evaluation of the RHINO gene for breast cancer predisposition in Finnish breast cancer families.
21659603 2011 A DNA damage response screen identifies RHINO, a 9-1-1 and TopBP1 interacting protein required for ATR signaling.
20811708 2010 Involvement of C12orf32 overexpression in breast carcinogenesis.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15221005 2004 Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11414747 2001 The role of CD40-CD40 ligand (CD154) interactions in immunoglobulin light chain repertoire generation and somatic mutation.