Property Summary

NCBI Gene PubMed Count 38
PubMed Score 50.69
PubTator Score 30.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -3.600 3.2e-05
astrocytic glioma -2.500 5.1e-03
Astrocytoma, Pilocytic -2.800 1.8e-06
atypical teratoid / rhabdoid tumor -4.600 9.7e-15
cystic fibrosis -1.874 9.1e-07
ependymoma -2.100 4.1e-02
glioblastoma -3.200 1.4e-09
group 4 medulloblastoma -1.100 3.6e-02
intraductal papillary-mucinous carcinoma... 1.300 4.6e-02
lung carcinoma 3.300 1.5e-40
malignant mesothelioma 2.100 2.8e-07
medulloblastoma, large-cell -3.100 1.3e-06
non primary Sjogren syndrome sicca -1.100 3.3e-02
oligodendroglioma -2.000 8.7e-03
Parkinson's disease -1.200 4.1e-02
Pick disease -1.500 1.3e-02
pituitary cancer -1.900 2.3e-04
primitive neuroectodermal tumor -2.900 1.7e-04
severe Alzheimer's disease -1.400 3.8e-02
subependymal giant cell astrocytoma -2.721 1.2e-02

Protein-protein Interaction (1)

Gene RIF (19)

AA Sequence

MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNL      1 - 70
TIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNK     71 - 140
ARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTT    141 - 210
EVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTEDELQQQIKYWQIQLDRHRLKMSKVA    211 - 280
DSLLSYTEQYLEYDPFLLPPDPSNPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKF    281 - 350
LESEFSSENLRFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFE    351 - 420
DAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKKSGNSMDRRTSFEKFAQNVGRNIPIFPCHKNCTPTLRA    421 - 490
STNLL                                                                     491 - 495
//

Text Mined References (41)

PMID Year Title