Property Summary

NCBI Gene PubMed Count 37
PubMed Score 49.54
PubTator Score 30.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma 2.100 2.8e-07
astrocytic glioma -3.400 1.4e-03
posterior fossa group A ependymoma -4.900 2.7e-17
oligodendroglioma -2.200 4.4e-12
glioblastoma -4.700 1.2e-06
sonic hedgehog group medulloblastoma -2.800 2.8e-05
cystic fibrosis -1.874 9.1e-07
atypical teratoid / rhabdoid tumor -5.700 1.6e-11
medulloblastoma, large-cell -3.200 7.7e-07
primitive neuroectodermal tumor -3.100 1.9e-03
intraductal papillary-mucinous carcinoma... 1.300 4.6e-02
Parkinson's disease -1.200 4.1e-02
pediatric high grade glioma -4.100 7.4e-08
pilocytic astrocytoma -2.900 7.5e-08
non primary Sjogren syndrome sicca -1.100 3.3e-02
subependymal giant cell astrocytoma -3.692 4.9e-02
severe Alzheimer's disease -1.400 3.8e-02
lung carcinoma 3.300 1.5e-40
Pick disease -1.700 3.5e-02
pituitary cancer -1.900 2.3e-04

Protein-protein Interaction (10)

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
1439 screening 770 / 33746 / 183961 Multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS7-Galphao.
1837 screening 129 / 0 / 1529 Single point concentration, multiplexed high-throughput screen for confirmation of small molecule regulators of RGS family protein interactions, specifically RGS7-Galphao.
1871 confirmatory 30 / 0 / 155 Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS7-Galphao.
2296 confirmatory 14 / 0 / 22 Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS7-Galphao for SAR Compounds
2826 confirmatory 0 / 0 / 5 Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS7-Galphao with additional round of SAR compounds.

Gene RIF (18)

PMID Text
26895961 R7-binding protein had a strong inhibitory effect on homo-oligomerization of RGS7.
26113603 Fine mapping of the uterine leiomyoma locus on 1q43 close to a lncRNA in the RGS7-FH interval
23857581 the GAP activity of RGS9-2 showed a strong receptor preference for D2R over MOR. Finally, RGS7 displayed an four times greater GAP activity relative to RGS9-2.
23054467 New single nucleotide polymorphisms associated with differences in platelets reactivity in patients with type 2 diabetes treated with acetylsalicylic acid: genome-wide association approach and pooled DNA strategy.
21343290 Gi/o signaling and the palmitoyltransferase DHHC2 regulate palmitate cycling and shuttling of RGS7 family-binding protein.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20627871 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19626040 common variation within the RGS7 locus may be involved in multiple sclerosis susceptibility.
19626040 Observational study of gene-disease association. (HuGE Navigator)
19376773 cytosolic chaperonin complex-dependent mechanism exists for Gbeta5-RGS7 assembly that utilizes the co-chaperone activity of PhLP1 in a unique way
19182865 The DEP domain of RGS7 can directly bind to the third intracellular loop of the M3R and attenuate receptor-induced Ca2+ mobilization in a M3 subtype-selective manner.
18762858 Observational study of gene-disease association. (HuGE Navigator)
16867977 cytoplasmic RGS7*Gbeta5*R7BP heterotrimers and RGS7*Gbeta5 heterodimers are equivalently inefficient regulators of G protein-coupled receptor signaling relative to plasma membrane-bound heterotrimers bearing palmitoylated R7BP.
15496508 Galpha-regulated plasma membrane localization and palmitoylation of RGS7.
12659861 could play a role in synaptic vesicle exocytosis through its interaction with snapin
12077120 tumor necrosis factor-alpha regulates the interaction of RGS7 with 14-3-3

AA Sequence

MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNL      1 - 70
TIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNK     71 - 140
ARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTT    141 - 210
EVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTEDELQQQIKYWQIQLDRHRLKMSKVA    211 - 280
DSLLSYTEQYLEYDPFLLPPDPSNPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKF    281 - 350
LESEFSSENLRFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFE    351 - 420
DAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKKSGNSMDRRTSFEKFAQNVGRNIPIFPCHKNCTPTLRA    421 - 490
STNLL                                                                     491 - 495
//

Text Mined References (40)

PMID Year Title
26895961 2016 Regulator of G Protein Signaling 7 (RGS7) Can Exist in a Homo-oligomeric Form That Is Regulated by G?o and R7-binding Protein.
26113603 2015 Fine mapping of the uterine leiomyoma locus on 1q43 close to a lncRNA in the RGS7-FH interval.
25199915 2015 GWAS of longevity in CHARGE consortium confirms APOE and FOXO3 candidacy.
25102180 2014 Meta-analysis of genome-wide association studies in African Americans provides insights into the genetic architecture of type 2 diabetes.
23857581 2013 Macromolecular composition dictates receptor and G protein selectivity of regulator of G protein signaling (RGS) 7 and 9-2 protein complexes in living cells.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23054467 2013 New single nucleotide polymorphisms associated with differences in platelets reactivity in patients with type 2 diabetes treated with acetylsalicylic acid: genome-wide association approach and pooled DNA strategy.
21343290 2011 Gi/o signaling and the palmitoyltransferase DHHC2 regulate palmitate cycling and shuttling of RGS7 family-binding protein.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20627871 2010 Genetic variations in regulator of G-protein signaling genes as susceptibility loci for second primary tumor/recurrence in head and neck squamous cell carcinoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19626040 2009 Follow-up examination of linkage and association to chromosome 1q43 in multiple sclerosis.
19376773 2009 Role of molecular chaperones in G protein beta5/regulator of G protein signaling dimer assembly and G protein betagamma dimer specificity.
19182865 2009 The Gbeta5-RGS7 complex selectively inhibits muscarinic M3 receptor signaling via the interaction between the third intracellular loop of the receptor and the DEP domain of RGS7.
18762858 2009 Association analysis of Rgs7 variants with panic disorder.
18434541 2008 Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16867977 2006 R7BP augments the function of RGS7*Gbeta5 complexes by a plasma membrane-targeting mechanism.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15897264 2005 Palmitoylation regulates plasma membrane-nuclear shuttling of R7BP, a novel membrane anchor for the RGS7 family.
15496508 2005 Palmitoylation and plasma membrane targeting of RGS7 are promoted by alpha o.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
12670932 2003 G beta 5.RGS7 inhibits G alpha q-mediated signaling via a direct protein-protein interaction.
12659861 2003 Snapin interacts with the N-terminus of regulator of G protein signaling 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12077120 2002 Interaction of 14-3-3 protein with regulator of G protein signaling 7 is dynamically regulated by tumor necrosis factor-alpha.
11152459 2001 Nuclear localization of G protein beta 5 and regulator of G protein signaling 7 in neurons and brain.
11032900 2000 RGS7 is palmitoylated and exists as biochemically distinct forms.
10862767 2000 14-3-3 interacts with regulator of G protein signaling proteins and modulates their activity.
10521509 1999 Regulators of G protein signaling 6 and 7. Purification of complexes with gbeta5 and assessment of their effects on g protein-mediated signaling pathways.
10339615 1999 Fidelity of G protein beta-subunit association by the G protein gamma-subunit-like domains of RGS6, RGS7, and RGS11.
10339594 1999 Interaction between RGS7 and polycystin.
10092682 1999 RGS7 and RGS8 differentially accelerate G protein-mediated modulation of K+ currents.
10051672 1999 Gbeta5 prevents the RGS7-Galphao interaction through binding to a distinct Ggamma-like domain found in RGS7 and other RGS proteins.
9572280 1998 RGS7 attenuates signal transduction through the G(alpha q) family of heterotrimeric G proteins in mammalian cells.
8548815 1996 EGL-10 regulates G protein signaling in the C. elegans nervous system and shares a conserved domain with many mammalian proteins.