Property Summary

NCBI Gene PubMed Count 39
PubMed Score 42.20
PubTator Score 37.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
interstitial lung disease -1.200 2.4e-02
posterior fossa group B ependymoma -1.200 2.7e-03
oligodendroglioma -1.200 6.5e-03
glioblastoma 1.700 1.9e-02
medulloblastoma, large-cell 1.400 4.1e-02
tuberculosis and treatment for 3 months -2.900 6.9e-07
non-small cell lung cancer -1.141 2.4e-06
lung cancer -1.500 1.9e-04
pancreatic cancer 1.700 4.9e-05
Breast cancer 2.200 3.7e-02
group 4 medulloblastoma -1.800 7.6e-03
invasive ductal carcinoma 1.100 1.6e-02
ovarian cancer 2.000 9.2e-03
pituitary cancer -2.800 1.5e-06

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1888 confirmatory 53 / 0 / 132 Dose respone, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS16-Galphao.
2298 confirmatory 25 / 0 / 11 Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS16-Galphao for SAR Compounds

Gene RIF (20)

PMID Text
26823172 suggest that deltaEF1 family proteins promote cell motility of breast cancer cells directly or indirectly through repressing expression of RGS16
26013170 The data establish miR-181a as an oncomiR that promotes chondrosarcoma progression through a new mechanism involving enhancement of CXCR4 signaling by inhibition of RGS16.
25366993 these results indicate that RGS16 restricts the activation-induced pro-inflammatory profile in myeloid cells.
23354309 cotreatment with RGS16 siRNA reversed the downregulation of nuclear factor-kappaB expression induced by combined inhibition of LSD1 and HDACs, suggesting a crucial role of RGS16 in controlling key pathways of cell death in response to combination therapy.
23248035 Data indicate that multiplex ligation-dependent probe amplification (MLPA) probes (Fig. 2) corresponding to the RGSL2, RGSL1 and RGS16 genes showed 64.5 % tumour samples with copy number gains and 5 % tumour samples with copy number losses.
21135262 Missense mutations in RGS16 gene is associated with breast cancer.
20627871 Observational study of gene-disease association. (HuGE Navigator)
20571966 RGS16 and FosB are underexpressed in pancreatic cancer with lymph node metastasis and associated with reduced survival
19760045 Increased RGS16 levels are associated with colorectal cancer.
19509421 the loss of RGS16 in some breast tumors enhances PI3K signaling elicited by growth factors and thereby promotes proliferation and TKI evasion downstream of HER activation
18521847 The promoter region of RGS16 was found to be methylated in 10% human breast carcinomas
18262772 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17635928 Regulator of G Signaling 16 has a role in the distinct endoplasmic reticulum stress state associated with aggregated mutant alpha1-antitrypsin Z in the classical form of alpha1-antitrypsin deficiency
17613536 B4GALT3, DAP3, RGS16, TMEM183A and UCK2--were significantly overexpressed in dup(1q)-positive ALLs compared with high hyperdiploid ALLs without dup(1q).
17347170 G alpha(i2) is specifically localized in human Fallopian tube epithelial cells, particularly in cilia, & is likely to have cilia-specific role in reproduction.
15998835 RGS16 is a negative regulator of SDF-1-CXCR4 signaling in megakaryocytes
14634662 RGS16 inhibits G alpha 13-mediated, RhoA-dependent reversal of stellation and Serum Response Element activation, thus regulating G alpha 13-mediated signal transduction independently of the RGS box.
12642593 results suggest that the amino-terminal palmitoylation of regulator of G-protein signaling 16 protein(RGS16) promotes its lipid raft targeting that allows palmitoylation of a poorly accessible cysteine residue
12642592 results suggest that palmitoylation of a Cys residue in the regulator of G protein signaling(RGS) box is critical for RGS16 and RGS4 GAPase activating protein activity and their ability to regulate G protein signaling in mammalian cells
12588871 Src mediates RGS16 tyrosine phosphorylation, which may promote RGS16 stability.

AA Sequence

MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSEDVLGWRESFDLLL      1 - 70
SSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETHELT     71 - 140
RMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT            141 - 202
//

Text Mined References (41)

PMID Year Title
26823172 2016 The potential role of regulator of G-protein signaling 16 in cell motility mediated by ?EF1 family proteins.
26013170 2015 miR-181a Targets RGS16 to Promote Chondrosarcoma Growth, Angiogenesis, and Metastasis.
25366993 2015 RGS16 restricts the pro-inflammatory response of monocytes.
23354309 2013 Crosstalk between lysine-specific demethylase 1 (LSD1) and histone deacetylases mediates antineoplastic efficacy of HDAC inhibitors in human breast cancer cells.
23248035 2013 Chromosome 1q25.3 copy number alterations in primary breast cancers detected by multiplex ligation-dependent probe amplification and allelic imbalance assays and its comparison with fluorescent in situ hybridization assays.
21784977 2011 Zinc finger protein tristetraprolin interacts with CCL3 mRNA and regulates tissue inflammation.
21135262 2011 High-resolution melting analysis for mutation screening of RGSL1, RGS16, and RGS8 in breast cancer.
20627871 2010 Genetic variations in regulator of G-protein signaling genes as susceptibility loci for second primary tumor/recurrence in head and neck squamous cell carcinoma.
20571966 2010 RGS16 and FosB underexpressed in pancreatic cancer with lymph node metastasis promote tumor progression.
19760045 2009 RGS16 is a marker for prognosis in colorectal cancer.
19509421 2009 RGS16 inhibits breast cancer cell growth by mitigating phosphatidylinositol 3-kinase signaling.
18521847 2008 A fragile site within the HPC1 region at 1q25.3 affecting RGS16, RGSL1, and RGSL2 in human breast carcinomas.
18434541 2008 Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.
18262772 2008 Association of RGS2 and RGS5 variants with schizophrenia symptom severity.
17635928 2007 Regulator of G Signaling 16 is a marker for the distinct endoplasmic reticulum stress state associated with aggregated mutant alpha1-antitrypsin Z in the classical form of alpha1-antitrypsin deficiency.
17613536 2007 Tiling resolution array comparative genomic hybridization, expression and methylation analyses of dup(1q) in Burkitt lymphomas and pediatric high hyperdiploid acute lymphoblastic leukemias reveal clustered near-centromeric breakpoints and overexpression of genes in 1q22-32.3.
17347170 2007 Localization and variable expression of G alpha(i2) in human endometrium and Fallopian tubes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15998835 2005 RGS16 is a negative regulator of SDF-1-CXCR4 signaling in megakaryocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14634662 2003 RGS16 inhibits signalling through the G alpha 13-Rho axis.
12642593 2003 Palmitoylation regulates regulators of G-protein signaling (RGS) 16 function. I. Mutation of amino-terminal cysteine residues on RGS16 prevents its targeting to lipid rafts and palmitoylation of an internal cysteine residue.
12642592 2003 Palmitoylation regulates regulator of G-protein signaling (RGS) 16 function. II. Palmitoylation of a cysteine residue in the RGS box is critical for RGS16 GTPase accelerating activity and regulation of Gi-coupled signalling.
12588871 2003 Src-mediated RGS16 tyrosine phosphorylation promotes RGS16 stability.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11602604 2001 RGS16 function is regulated by epidermal growth factor receptor-mediated tyrosine phosphorylation.
11522288 2001 Multiple phosphorylation sites in RGS16 differentially modulate its GAP activity.
10878019 2000 Polarity exchange at the interface of regulators of G protein signaling with G protein alpha-subunits.
10836135 2000 The regulator of G protein signaling family.
10791963 2000 Cytoplasmic, nuclear, and golgi localization of RGS proteins. Evidence for N-terminal and RGS domain sequences as intracellular targeting motifs.
10760272 2000 MIR16, a putative membrane glycerophosphodiester phosphodiesterase, interacts with RGS16.
10747990 2000 Ca2+/Calmodulin reverses phosphatidylinositol 3,4, 5-trisphosphate-dependent inhibition of regulators of G protein-signaling GTPase-activating protein activity.
10373502 1999 Amino-terminal cysteine residues of RGS16 are required for palmitoylation and modulation of Gi- and Gq-mediated signaling.
10072511 1999 Regulators of G protein signaling exhibit distinct patterns of gene expression and target G protein specificity in human lymphocytes.
9469939 1998 Cloning of a retinally abundant regulator of G-protein signaling (RGS-r/RGS16): genomic structure and chromosomal localization of the human gene.
9271201 1997 Interaction of human retinal RGS with G-protein alpha-subunits.
9223279 1997 The p53 tumor suppressor targets a novel regulator of G protein signaling.
9079700 1997 Characterization of a novel mammalian RGS protein that binds to Galpha proteins and inhibits pheromone signaling in yeast.
8917514 1996 RGS-r, a retinal specific RGS protein, binds an intermediate conformation of transducin and enhances recycling.