Property Summary

Ligand Count 2,305
NCBI Gene PubMed Count 234
PubMed Score 33160.73
PubTator Score 17376.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Hypertensive disorder 56
Disease Target Count P-value
urothelial carcinoma 318 5.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.700 1.6e-03
urothelial carcinoma -2.200 5.0e-02

Protein-protein Interaction (1)

PDB (87)

Gene RIF (194)

AA Sequence

MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLG      1 - 70
NTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKH     71 - 140
NGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIF    141 - 210
DNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSST    211 - 280
LLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADY    281 - 350
VFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR                  351 - 406
//

Text Mined References (233)

PMID Year Title