Property Summary

Ligand Count 2,304
NCBI Gene PubMed Count 234
PubMed Score 33160.73
PubTator Score 17376.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Hypertensive disorder 57
Disease Target Count P-value
urothelial carcinoma 318 5.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.700 1.6e-03
urothelial carcinoma -2.200 5.0e-02

Synonym

Accession P00797 Q6FI38 Q6T5C2
Symbols HNFJ2

Gene

REN

PANTHER Protein Class (3)

PDB

2X0B   1BBS   1BIL   1BIM   1HRN   1RNE   2BKS   2BKT   2FS4   2G1N   2G1O   2G1R   2G1S   2G1Y   2G20   2G21   2G22   2G24   2G26   2G27   2I4Q   2IKO   2IKU   2IL2   2REN   2V0Z   2V10   2V11   2V12   2V13   2V16   3D91   3G6Z   3G70   3G72   3GW5   3K1W   3KM4   3O9L   3OAD   3OAG   3OOT   3OQF   3OQK   3OWN   3Q3T   3Q4B   3Q5H   3SFC   3VCM   3VSW   3VSX   3VUC   3VYD   3VYE   3VYF   4AMT   4GJ5   4GJ6   4GJ7   4GJ8   4GJ9   4GJA   4GJB   4GJC   4GJD   4PYV   4Q1N   4RYC   4RYG   4RZ1   4S1G   4XX3   4XX4   5KOQ   5KOS   5KOT   5SXN   5SY2   5SY3   5SZ9   5T4S   5TMG   5TMK   5V8V   5VPM   5VRP  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Protein-protein Interaction (1)

Gene RIF (194)

AA Sequence

MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLG      1 - 70
NTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKH     71 - 140
NGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIF    141 - 210
DNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSST    211 - 280
LLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADY    281 - 350
VFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR                  351 - 406
//

Text Mined References (233)

PMID Year Title