Property Summary

NCBI Gene PubMed Count 224
PubMed Score 31987.60
PubTator Score 17376.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Hypertensive disorder 58
Disease Target Count P-value
urothelial carcinoma 318 5.0e-02

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 3.700 1.4e-70
urothelial carcinoma -2.200 5.0e-02

Protein-protein Interaction (2)

Gene RIF (186)

PMID Text
26753721 The present study provides evidence that the rs1464816 polymorphism in REN is associated with CKD progression in ADPKD.
26489635 Increased plasma renin, AT and VEGF might play a role in the onset or development of superficial infantile hemangiomas.
26366736 The results suggest that variants in the enhancer region of the human renin gene have an effect on the expression levels of renin in renal tissue; this observation is in good accordance with the results of the transcriptional assay.
26163660 Active renin was not significantly different between hypertensive patients with and without left ventricular hypertrophy.
26102248 our data suggest that the renin polymorphism plays an important role in the risk of developing coronary artery disease with the highest risk for C allele, but do not support its role as a risk factor for developing restenosis after coronary stenting
26076559 This study showed no involvement of A/G renin polymorphisms in the pathogenesis of heart failure.
25849646 Salt supplementation blunts the telmisartan induced increase in plasma renin activity in patients with type 2 diabetes.
25767135 Elevated levels of circulating (pro)renin were observed in pre-eclampsia patients
25660845 We conclude that heterozygous substitutions at AGT and REN loci correlate significantly with end-stage renal disease in a north Indian population
25534858 Data show that administration of bone-marrow-derived stromal cells (BMSCs) with human transgenic angiotensinogen and renin genes in the mouse acute kidney injury (AKI) model resulted in exacerbation of kidney injury.
25510769 the A allele of rs6682082 of renin is a positive genetic marker for predisposition to essential hypertension and high blood pressure in Korean women.
25491485 Demonstrate that there are strong interactions between prorenin, ATP6AP2, and TGFB1 and that this system has a greater capacity in female amnion to stimulate profibrotic pathways, thus maintaining the integrity of the fetal membranes.
25333683 Primary aldosteronism seems associated with a lower level of prorenin than essential hypertension
25279703 the aldosterone-renin ratio may have role in total and cancer death in Japanese individuals
25237165 Plasma renin and Aldosterone to renin ratio but not aldosterone are independently associated with presence of carotid plaques in coronary artery disease patients.
25143328 concentrations of serum aldosterone, plasma direct renin, and plasma renin activity were measured after a night's rest and again after walking for two hours.
24970860 Renin cleaves HIV-1 Gag to enhance HIV-1 replication in human T cells
24965793 Activation of the renin-angiotensin system in the subfornical organ is sufficient to mediate an increase in drinking through PKC pathway.
24742480 Urinary renin levels should be measured by established renin assays.
24436325 Report ethnic differences in association of plasma renin levels with blood pressure.
24284398 These data suggest the importance of the activated oxidative stress/AGT/RAS axis in the pathogenesis of diabetic nephropathy.
24218434 Plasma sPRR concentrations are dependent on ethnicity and independent of renin, prorenin, and aldosterone concentrations in healthy subjects and in patients with contrasted degrees of renin-angiotensin system activity.
24164175 Data suggest that the renin-angiotensin system plays a critical role in placentation and nephrogenesis.
24154707 Aliskiren prevents renal disease progression by suppressing both angiotensin I and II in human renin angiotensinogen transgenic mice with high salt loading.
23461768 No significant differences in plasma renin activity are found between patients with polycystic ovary syndrome and controls.
23358739 We sho a gender-dependent association of the renin rs6693954 SNP with central and ambulatory BP in patients with type 2 diabetes mellitus.
23292178 the main site of renin in the end-stage kidney is the juxtaglomerular cells.
23111329 These in vitro data indicate that prorenin acidified in vivo possibly modulate renin angiotensin system in (pro)renin receptor-dependent and/or -independent manners which could ultimately lead to the pathogenesis of diseases.
23108193 renin gene Mbo I site polymorphism is not associated with blood pressure levels and risk of hypertension.
23077077 The levels of circulating and local renin-angiotensin-aldosterone system expressions were different in atrial fibrillation patients with different types of mitral valvular diseases.
22721990 Prorenin is a chemotactic factor for human aortic smooth muscle cells expressing prorenin receptor.
22695510 We observed a disproportionately high level of prorenin in blacks. These high circulating prorenin levels however do not result in greater adrenal angiotensin II and aldosterone production in healthy young blacks.
22676457 in twin pregnancies, relative to singleton pregnancies, second trimester plasma level elevated and third trimester level reduced
22575890 X-ray structure of a prorenin sheds light on a novel mechanism of its autoinhibition and on its non-proteolytic activation by the (pro)renin receptor
22459392 Plasma renin activity identifies a group of high risk patients for heart failure in patients with chronic kidney disease.
22453004 A direct renin inhibitor combined with an ACEI or an ARB can better improve the extent of myocardial salvage after acute myocardial infarction.
22396488 Aldosterone rise that often occurs during prolonged renin-angiotensin system blockade is rather due to the angiotensin II 'escape' during such blockade.
22136493 The inhibition activity of baicalin against renin was a result of the formation of stable complex through multisites binding including the active site.
22042811 Hsa-miR-663 can bind to the REN 3' untranslated regions and can regulate REN mRNA levels, whereas hsa-miR-181a regulated REN mRNA.
22022827 Results demonstrate that the Liaison((R)) direct renin assay may assist the clinician in the assessment of hypertensive patients and in the screening for primary aldosteronism.
21941205 plasma renin activity and aldosterone-renin ratio is associated with prevalence of chronic kidney disease
21941204 increased urinary renin levels in diabetes and decreased urinary renin levels following RAAS blockade reflect the activated renal RAAS in diabetes and the success of RAAS blockade in the kidney
21881521 prorenin can be detected with a monoclonal antibody directed against residues 32-39 of the prosegment
21831501 Data suggest that REN expression in placenta is higher in severe preeclampsia (but not in preeclampsia responsive to antihypertensives) as compared to control subjects. In this study, concordant expression of KiSS-1 and REN genes was not observed.
21742440 Neither "living alone" nor depressive symptomatology alone were associated with activation of renn-angiotensin-aldersterone system, but living alone and depressive symptomatology yielded a highly significant increase in the aldosterone and renin
21712789 In women with hypothyroidism, basal and poststimulatory plasma renin is low
21697610 There was a significant relationship between biological variation in BNP and biological variation in PRC
21659414 renin has a role as an Ang II-independent profibrotic factor in lung fibrosis
21576655 Renin-angiotensin-aldosterone system-upregulation genotypes are associated with failure of reverse remodeling after superior cavopulmonary connection surgery, less improvement in renal function, and impaired somatic growth.
21521263 Data suggest that Fok1 polymorphism of the VDR gene, in combination with 25(OH)D levels, was associated with PRA in hypertension.
21490026 Polymorphisms in the renin gene are associated with increased risk for hypertension in an independent cohort.
21443456 The renin prosequence [1-43] optimizes renin activity possibly through appropriate protein folding and it enhances the constitutive secretion of (pro)renin.
21424086 The results show the role of plasma renin dosing as being particularly important in the pathogenesis of secondary hypertension in young adults.
21340620 In type 1 diabetic women with pre-eclampsia, a higher concentration of prorenin in early pregnancy and higher levels of prorenin and SSAO throughout pregnancy were seen.
21330422 25-hydroxyvitamin D is inversely associated with plasma renin activity and positively associated with salt sensitivity of blood pressure in low renin hypertension subjects.
21330419 The aim was to determine whether serum prorenin levels affect the development of diabetic retinopathy (DR) in type 2 diabetes.
21163863 The aim of this study was to evaluate allele and haplotype distributions of REN polymorphisms, and to estimate normalised linkage disequilibrium (D') in Mexican and German populations.
21111986 Higher plasma renin activity was a strong predictor of mortality in patients with chronic heart failure.
21084044 A novel REN gene mutation resulted in an alteration in the amino acid sequence of the renin signal sequence and caused childhood anemia, polyuria, and kidney disease. Treatment with fludrocortisone improved renal function in an affected child.
21036942 three mutants were misfolded to different levels, were enzymatically inactive and exhibited abnormal intracellular trafficking
20925572 the presence of renin BglI B allele is associated with an increased risk in developing essential hypertension (Meta-Analysis)
20925572 Meta-analysis of gene-disease association. (HuGE Navigator)
20884641 Renin and PPAR-gamma differentially contribute to the control of the length of cardiomyocytes.
20861226 In addition to its direct effect on renin gene transcription, PPARgamma "sensitizes" renin gene to cAMP via trans-activation of AC6 gene.
20826507 A specific prorenin propart binding site was not detected in endothelial cells.
20702505 Decidual prorenin may be involved in the labour-associated increase in amnion PGHS-2 abundance via the (pro)renin receptor.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20662730 Renin gene I/D polymorphism is associated with essential hypertension (EH), whereas angiotensinogen gene M235T, A-6G, and A-20C polymorphisms and the haplotypes are not associated with EH in the Mongolian population.
20662730 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20619546 Renin is frequently expressed in renal epithelial neoplasms with granular cells, mainly in oncocytomas, but this renin appears clinically inactive.
20577119 Observational study of gene-disease association. (HuGE Navigator)
20537141 Findings indicate that the mother's risk for developing pre-eclampsia is not influenced by fetal REN haplotypes.
20537141 Observational study of gene-disease association. (HuGE Navigator)
20529973 The SS genotype of the AGT gene was related with an increased risk for 3-vessel CAD
20529973 Observational study of gene-disease association. (HuGE Navigator)
20502328 This review discusses recent discoveries regarding the mechanisms that control the identity and fate of renin cells and their role in the maintenance of kidney architecture and function--{REVIEW}
20486282 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20429690 REN was incorporated into transgenic rats for a study on resveratrol and mitochondrial biogenesis in a system where AngII-induced cardiac remodeling was functioning.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20223792 There is no association of the analysed renin-angiotensin-aldosterone system polymorphisms with severe coronary artery disease in coronary artery bypass grafting patients.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20160196 The carriage of a REN-5312T allele of renin is associated with elevated diastolic blood pressure.
20160196 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19891555 Observational study of gene-disease association. (HuGE Navigator)
19761684 De novo CML patients had increased ACE, angiotensinogen and renin mRNA levels and these expression levels decreased following administration of imatinib.
19759335 Ischemia-induced brain damage is enhanced in human renin and angiotensinogen double-transgenic mice.
19733264 prospective crucial regions in renin and prorenin responsible for their interaction with the (pro)renin receptor [PRR] were investigated using various kinds of peptides
19716087 Observational study of gene-disease association. (HuGE Navigator)
19673942 Cellular expression of renal, cardiac and pulmonary inducible nitric oxide synthase in double-transgenic mice expressing human renin and angiotensinogen genes.
19664745 Dominant renin gene mutations associated witrh early-onset hyperuricemia, anemia, and chronic kidney failure are reported.
19536175 Observational study of gene-disease association. (HuGE Navigator)
19513539 prorenin, renin and the peptides bind to (P)RR and the decoy reduces prorenin binding, supporting our hypothesis that decoy peptide region has a crucial role in prorenin binding.
19509012 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19473121 Angiotensinogen (AGT) M235T and AGT G-6A, but not AGT T174M or renin-4063C/T SNPs, were significantly associated with an increased risk of stroke.
19369955 Pretreatment levels of plasma renin activity predict ambulatory blood pressure response to valsartan in essential hypertension. (Letter)
19243623 Observational study of gene-disease association. (HuGE Navigator)
19144755 Present a new strategy to analyze possible association structures between dynamic nocturnal hormone activities and sleep alterations in humans.
19126660 Observational study of gene-disease association. (HuGE Navigator)
19082699 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19073901 Normotensive sodium loading in normal man: regulation of renin secretion during beta1-receptor blockade.
19023100 reduction of cerebral blood flow in the peripheral region of the middle cerebral artery after occlusion was markedly exaggerated in human renin/angiotensinogen trangenic mice
18953568 Observational study of gene-disease association. (HuGE Navigator)
18922597 prorenin and the (pro)renin receptor play a pivotal role in the pathophysiology of diabetic nephropathy
18856058 The analysis of carriership of the alleles and genotypes combinations of the polymorphous regions has shown that genes CYP11B2, REN, ACE, CMA andA T2R1 participate in development of low-renin HA
18856058 Observational study of gene-disease association. (HuGE Navigator)
18794727 renin and endothelin-1 have a key role in the edema caused by PPARgamma agonists
18722896 Mean postnatal active plasma(umbilical vein) renin level in the Fetal growth restriction infants was significantly higher than normal infants
18718746 Weight loss is associated with reduction of blood pressure and of plasma renin levels in obese hypertensive subjects after laparoscopic gastric banding.
18698213 equal ligand activities of both, renin and prorenin, on the (pro)renin receptor - promyelocytic zinc finger protein-phosphatidylinositol-3 kinase-p85alpha pathway
18632798 There are sequences in and around the renin and ETNK2 loci which act as boundaries between neighboring genes which insulate them from each other.
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18508487 Renal renin/prorenin enter tissue sites in humans, and renal renin is the main determinant of plasma angiotensins after nephrectomy.
18486430 Renin levels correlate with obsessive craving in medium-term abstinent alcohol-dependent patients.
18483152 The human renin Pal3 site appears to be critical for the PPARgamma-dependent regulation of gene expression.
18325076 Observational study of gene-disease association. (HuGE Navigator)
18260994 Participation of REN gene in development of low renin AH was convincingly shown.
18260994 Observational study of gene-disease association. (HuGE Navigator)
18259612 transcriptional regulation of renin expression via RP-2 but not CNRE is critical for blood pressure regulation by this gene.
18212269 Prorenin and renin-induced ERK 1/2 activation are independent of angiotensin II. The signal transduction is different from that evoked by angiotensin II.
18205094 association of the polymorphisms of the genes of the renin-angiotensin system in preterm delivery and premature rupture of membranes
18202178 Human lung mast cells express enzymatically active renin; analysis of lung mast cell RNA reveals renin transcript that is homologous to human kidney renin.
18192836 Genotype GG of the rs5707 polymorphisms of the renin gene were associated with blood pressure levels and risk of hypertension in women over 40 years old
18192836 Observational study of gene-disease association. (HuGE Navigator)
18188989 Observational study of gene-disease association. (HuGE Navigator)
18175911 Serine 84 in renin brings a pH profile of two separate peaks at pHs 5.5 and 8.2 to the reaction of human renin and sheep angiotensinogen.
18091737 Measurement of plasmin renin activity levels before treatment is thought to be useful for prediction of the ambulatory blood pressure lowering effects of telmisartan.
18077515 Chorionic enhancer is silent in vivo, at least in the transgenic mouse for human renin gene
17851801 While renin expressions increased in the local cord blood of pre-eclampsia in comparison to the normal cord blood, unpredictable decrements in the angiotensinogen and ACE expressions were observed within the same pre-eclamptic samples.
17785633 We found that PPARgamma targets a palindromic repeat with a 3-bp spacer (Pal3) in the proximal human renin promoter. Renin is the first gene described with a functional Pal3 sequence. PPARgamma agonists also stimulated renin gene expression.
17703434 Antagonists of renin in transgenic rats prevent renin-angiotensin system inhibition and prevent damage in an angiotensin ii model of hypertenion.
17693975 Plasma renin in the hypertensive subjects were lower in the Jordan Valley, but similar to normotensives in Irbid City.
17660193 Investigation of the regulatory role of a conserved region of 800 bp in size, 14 kb upstream of the renin gene which is located upstream of a known 11 kb upstream regulatory region of the renin gene.
17562974 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17546276 Observational study of gene-disease association. (HuGE Navigator)
17485830 Ser84 of human renin contributes to the biphasic pH dependence of the renin-angiotensinogen reaction.
17476284 Strong association of the renin TaqI polymorphism with essential hypertension in Chinese Han and Tibetan populations.
17455195 the DR motif site of the renin gene functions as a negative regulatory element involved in a twofold repression of transcription; nucleic receptors bind the site and are important in renin gene expression; one of the binding proteins may be COUP-TFII.
17416596 Angiotensinogen/renin transgenic rats develop hypertension. Remodeling in the heart conduction sytsem leads to ventricular tachycardia and sudden arrhythmic death.
17158202 Silent polymorphisms in the renin promoter and enhancer in hypertensive patients.
16990260 This study suggested that sequences other than the enhancer may be necessary for tissue-specific, cell-specific, and regulated expression of human RENIN.
16940215 Prorenin-induced stimulation of p38 MAPK/HSP27 pathway, resulting in alterations in actin filament dynamics, may underlie severe cardiac hypertrophy previously seen in rats with hepatic prorenin overexpression.
16933186 The group of hypertensive obese women showed significantly reduced plasma levels of renin and increased aldosterone/renin quotient (ARQ) compared to obese normotensive women.
16790508 Mutation of REN leads to an autosomal recessive renal tubular dysgenesis in heterozygotes.
16672053 Observational study of gene-disease association. (HuGE Navigator)
16615274 Observational study of gene-disease association. (HuGE Navigator)
16446393 These data support the concept of an intracellular form of renin in the brain, which may provoke functional changes in fluid homeostasis and BP regulation.
16396763 The expression of Renin gene by the use of real-time quantitative PCR (RQ-PCR) at diagnosis in acute myeloid leukemia patients (AML) and to assess its possible relevance in the prognosis and outcome of such patients.
16375820 It appears possible that renin and ET may contribute to the pathophysiological changes associated with premature labor and preeclampsia
16189286 renin angiotensin-forming enzyme is expressed in podocytes
16138564 Observational study of gene-disease association. (HuGE Navigator)
16138564 REN 10631A alleles are significantly associated with essential hypertension in the Emirati population
16036389 Observational study of gene-disease association. (HuGE Navigator)
16036389 The missense mutation in the human renin gene was found not to be associated in patients with preeclampsia.
15914769 human renin and human angiotensinogen have roles in development of hypertension in transgenic mice, and may predispose to spontaneous stroke
15914614 Observational study of gene-disease association. (HuGE Navigator)
15739123 Plasma cathepsin D isoforms and their active metabolites increase after myocardial infarction and contribute to plasma renin activity.
15662219 Genetic polymorphisms of renin and kidney failure in hypertension were studied.
15368359 putative cis-elements and each corresponding trans-factor in the specific expression of the human renin gene in the promoter region
15075192 dual production of renin and angiotensinogen in the renal proximal tubule can result in a systemic increase in arterial pressure
14530292 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12933794 HADHB trifunctional enzyme, human renin, and poly(C)-binding protein are novel renin mRNA-binding proteins that target a cis-element in the 3'-UTR of renin mRNA and regulate renin production
12862204 Observational study of gene-disease association. (HuGE Navigator)
12862204 a novel variable number of tandem repeat polymorphism in the renin gene was not associated with essential hypertension
12854169 In normal subjects the expression of local renin and angiotensinogen mRNA was organ specific, but with increase of the expression locally, the organ-specificity became lost in cirrhotic patients.
12736712 male mice heterozygous for the human renin gene showed moderate weight gain compared with transgenic and wild-type mice. Obese hRN8-12 mice exhibited hyperglycemia, hyperinsulinemia, hyperleptinemia, and hyperlipidemia
12695419 Observational study of gene-disease association. (HuGE Navigator)
12684512 The binding "gate and handle" regions of this protein are critical for its non-proteolytic activation.
12613527 renin expression observed in leukemia cells disappeared with remission induction, but did not disappear with induction of cell differentiation in vivo, indicating that renin expression is associated with a blastic phenotype rather than cell proliferation.
12569263 Repression of renin expression by intracellular calcium may be mediated by the calcium-induced translocation of Ref-1 to the nucleus, where it binds to the renin promoter nCaRE, to repress the transcription of the renin gene.
12556231 Observational study of genotype prevalence. (HuGE Navigator)
12544508 Observational study of gene-environment interaction. (HuGE Navigator)
12473863 Human renin enhancer not only comprises the 225 bp element, but also extends to the region containing the -5312 SNP.
12431445 Review. The various ways through which circulating renin may reach cardiac tissue sites, considering in particular the possibility that prorenin, the inactive precursor of renin, is involved in cardiac angiotensin generation.
12431442 Review. Evidence that the cardiac renin-angiotensin system participates importantly in the development and risk of hypertensive heart disease.
12394950 Observational study of gene-disease association. (HuGE Navigator)
12186695 in contrast to results for ACE blood and bone marrow levels in leukemia patients, renin levels did not vary significantly between bone marrow and peripheral blood.
12045255 Pivotal role of the renin/prorenin receptor in angiotensin II production and cellular responses to renin
11903315 New elements in human renin promoter involved in cell-specific expression
11803527 Observational study of gene-disease association. (HuGE Navigator)
11800056 higher relative left ventricular wall thickness was not attributable to plasma concentrations of renin, angiotensin-II, aldosterone, epinephrine and norepinephrine
11776100 Observational study of gene-disease association. (HuGE Navigator)
11409653 Observational study of gene-disease association. (HuGE Navigator)
11224002 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLG      1 - 70
NTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKH     71 - 140
NGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIF    141 - 210
DNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSST    211 - 280
LLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADY    281 - 350
VFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR                  351 - 406
//

Text Mined References (224)

PMID Year Title
26753721 2016 Renin gene rs1464816 polymorphism contributes to chronic kidney disease progression in ADPKD.
26489635 2015 Effect of topical propranolol gel on plasma renin, angiotensin II and vascular endothelial growth factor in superficial infantile hemangiomas.
26366736 2015 A Genetic Variant in the Distal Enhancer Region of the Human Renin Gene Affects Renin Expression.
26163660 2016 Association of Post-Saline Load Plasma Aldosterone Levels With Left Ventricular Hypertrophy in Primary Hypertension.
26102248 2015 The C4280A (rs5705) gene polymorphism of the renin (REN) gene is associated with risk of developing coronary artery disease, but not with restenosis after coronary stenting.
26076559 Renin Genetic Polymorphism in Heart Failure Patients.
25849646 2015 Short-term dietary salt supplementation blunts telmisartan induced increases in plasma renin activity in hypertensive patients with type 2 diabetes mellitus.
25767135 2015 Elevation of (Pro)Renin and (Pro)Renin Receptor in Preeclampsia.
25660845 2015 M235T polymorphism in the AGT gene and A/G(I8-83) substitution in the REN gene correlate with end-stage renal disease.
25534858 2015 Exacerbation of acute kidney injury by bone marrow stromal cells from rats with persistent renin-angiotensin system activation.
25510769 2015 A polymorphism of the renin gene rs6682082 is associated with essential hypertension risk and blood pressure levels in Korean women.
25491485 2015 Effects of Fetal Sex on Expression of the (Pro)renin Receptor and Genes Influenced by its Interaction With Prorenin in Human Amnion.
25333683 2015 Decreased plasma prorenin levels in primary aldosteronism: potential diagnostic implications.
25279703 2015 Lower aldosterone-renin ratio is a risk factor for total and cancer death in Japanese individuals: the Takahata study.
25237165 2015 Plasma renin level and aldosterone to renin ratio are associated with presence of carotid plaques in patients with stable coronary artery disease.
25143328 2015 The ratios of aldosterone / plasma renin activity (ARR) versus aldosterone / direct renin concentration (ADRR).
24965793 2014 Activation of the renin-angiotensin system, specifically in the subfornical organ is sufficient to induce fluid intake.
24742480 2014 Methodologic issues in the measurement of urinary renin.
24436325 2014 Association of renin and aldosterone with ethnicity and blood pressure: the Multi-Ethnic Study of Atherosclerosis.
24284398 2013 Oxidative stress/angiotensinogen/renin-angiotensin system axis in patients with diabetic nephropathy.
24218434 2014 Plasma soluble (pro)renin receptor is independent of plasma renin, prorenin, and aldosterone concentrations but is affected by ethnicity.
24164175 2013 The renin-angiotensin system from conception to old age: the good, the bad and the ugly.
24154707 2014 Renin inhibition ameliorates renal damage through prominent suppression of both angiotensin I and II in human renin angiotensinogen transgenic mice with high salt loading.
23461768 2013 Studying the correlation of renin-angiotensin-system (RAS) components and insulin resistance in polycystic ovary syndrome (PCOs).
23358739 2014 Associations of genetic polymorphisms in the renin-angiotensin system with central aortic and ambulatory blood pressure in type 2 diabetic patients.
23292178 2013 Renin production site in the end-stage kidney.
23111329 2012 Acid-activated prorenin binds to (pro)renin receptor in vitro.
23108193 2013 Contribution of REN gene MBbo I polymorphism in conferring risk for essential hypertension: a case control study from South India.
23077077 2013 Circulating and local renin-angiotensin-aldosterone system express differently in atrial fibrillation patients with different types of mitral valvular disease.
22721990 2012 Chemotactic effect of prorenin on human aortic smooth muscle cells: a novel function of the (pro)renin receptor.
22695510 2012 Plasma levels of prorenin and renin in blacks and whites: their relative abundance and associations with plasma aldosterone concentration.
22676457 2012 Plasma aldosterone concentration and plasma renin activity decrease during the third trimester in women with twin pregnancies.
22575890 2012 Human prorenin structure sheds light on a novel mechanism of its autoinhibition and on its non-proteolytic activation by the (pro)renin receptor.
22459392 2013 Prognostic value of plasma renin activity in heart failure patients with chronic kidney disease.
22453004 2012 Effect of direct renin inhibitor, aliskiren, on peripheral blood monocyte subsets and myocardial salvage in patients with primary acute myocardial infarction.
22396488 2012 Renin and prorenin have no direct effect on aldosterone synthesis in the human adrenocortical cell lines H295R and HAC15.
22136493 2012 Inhibitory activities of baicalin against renin and angiotensin-converting enzyme.
22042811 2011 Gene expression profiling reveals renin mRNA overexpression in human hypertensive kidneys and a role for microRNAs.
22022827 2011 Two-site automated chemiluminescent assay for measurement of immunoreactive renin.
21941205 2011 Association of plasma renin activity and aldosterone-renin ratio with prevalence of chronic kidney disease: the Kaiser Permanente Southern California cohort.
21941204 2011 Urinary renin, but not angiotensinogen or aldosterone, reflects the renal renin-angiotensin-aldosterone system activity and the efficacy of renin-angiotensin-aldosterone system blockade in the kidney.
21881521 2011 Evaluation of a direct prorenin assay making use of a monoclonal antibody directed against residues 32-39 of the prosegment.
21831501 2011 Comparative expression profiles for KiSS-1 and REN genes in preeclamptic and healthy placental tissues.
21742440 2012 To live alone and to be depressed, an alarming combination for the renin-angiotensin-aldosterone-system (RAAS).
21712789 2011 Changes of poststimulatory plasma renin activity in women with hyperthyroidism or hypothyroidism in relation to therapy.
21697610 2011 Relationship between biological variation in B-type natriuretic peptide and plasma renin concentration in stable outpatients with dilated cardiomyopathy.
21659414 2012 Renin is an angiotensin-independent profibrotic mediator: role in pulmonary fibrosis.
21576655 2011 Renin-angiotensin-aldosterone genotype influences ventricular remodeling in infants with single ventricle.
21521263 2011 The Fok1 vitamin D receptor gene polymorphism is associated with plasma renin activity in Caucasians.
21490026 2011 Renin gene polymorphism: its relationship to hypertension, renin levels and vascular responses.
21443456 2011 The renin prosequence enhances constitutive secretion of renin and optimizes renin activity.
21424086 2011 The role of increased plasmatic renin level in the pathogenesis of arterial hypertension in young adults.
21340620 2011 A high concentration of prorenin in early pregnancy is associated with development of pre-eclampsia in women with type 1 diabetes.
21330422 2011 25-Hydroxyvitamin D is associated with plasma renin activity and the pressor response to dietary sodium intake in Caucasians.
21330419 2011 Higher levels of prorenin predict development of diabetic retinopathy in patients with type 2 diabetes.
21163863 2011 Renin gene haplotype diversity and linkage disequilibrium in two Mexican and one German population samples.
21111986 2010 Elevated plasma renin activity predicts adverse outcome in chronic heart failure, independently of pharmacologic therapy: data from the Valsartan Heart Failure Trial (Val-HeFT).
21084044 2010 Clinical and molecular characterization of a family with a dominant renin gene mutation and response to treatment with fludrocortisone.
21036942 2011 Loss-of-function point mutations associated with renal tubular dysgenesis provide insights about renin function and cellular trafficking.
20927107 2010 A redox switch in angiotensinogen modulates angiotensin release.
20925572 2010 Association of renin BglI polymphism with essential hypertension: a meta-analysis involving 1811 cases and 1626 controls.
20884641 2011 Controlling cardiomyocyte length: the role of renin and PPAR-{gamma}.
20861226 2010 PPARgamma-dependent regulation of adenylate cyclase 6 amplifies the stimulatory effect of cAMP on renin gene expression.
20826507 2011 A specific binding site for the prorenin propart peptide Arg10-Arg20 does not occur on human endothelial cells.
20702505 2011 Molecular evidence of a (pro)renin/ (pro)renin receptor system in human intrauterine tissues in pregnancy and its association with PGHS-2.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20662730 2010 Association of the renin gene polymorphism, three angiotensinogen gene polymorphisms and the haplotypes with essential hypertension in the Mongolian population.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20619546 2010 Renin expression in adult renal epithelial tumors with granular cells.
20577119 2010 Pharmacogenetic association of hypertension candidate genes with fasting glucose in the GenHAT Study.
20537141 2010 Maternal angiotensinogen (AGT) haplotypes, fetal renin (REN) haplotypes and risk of preeclampsia; estimation of gene-gene interaction from family-triad data.
20529973 2010 Polymorphisms of renin-angiotensin system and natriuretic peptide receptor A genes in patients of Greek origin with a history of myocardial infarction.
20502328 2010 The renin phenotype: roles and regulation in the kidney.
20486282 2010 Genetic variants in the renin-angiotensin-aldosterone system and salt sensitivity of blood pressure.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20429690 2010 Resveratrol induces mitochondrial biogenesis and ameliorates Ang II-induced cardiac remodeling in transgenic rats harboring human renin and angiotensinogen genes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20223792 2010 Renin-angiotensin-aldosterone system gene polymorphisms in coronary artery bypass graft surgery patients.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20160196 2010 Confirmation that the renin gene distal enhancer polymorphism REN-5312C/T is associated with increased blood pressure.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19891555 2009 Genetic variation in CYP27B1 is associated with congestive heart failure in patients with hypertension.
19761684 Effects of imatinib mesylate on renin-angiotensin system (RAS) activity during the clinical course of chronic myeloid leukaemia.
19759335 2009 Ischemia-induced brain damage is enhanced in human renin and angiotensinogen double-transgenic mice.
19733264 2009 Prorenin has high affinity multiple binding sites for (pro)renin receptor.
19716087 2009 Genetic variation in angiotensin-converting enzyme-related pathways associated with sudden cardiac arrest risk.
19673942 2009 Cellular expression of renal, cardiac and pulmonary inducible nitric oxide synthase in double-transgenic mice expressing human renin and angiotensinogen genes.
19664745 2009 Dominant renin gene mutations associated with early-onset hyperuricemia, anemia, and chronic kidney failure.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19513539 2009 'Decoy peptide' region (RIFLKRMPSI) of prorenin prosegment plays a crucial role in prorenin binding to the (pro)renin receptor.
19509012 2009 Genetic variant of the Renin-Angiotensin system and diabetes influences blood pressure response to Angiotensin receptor blockers.
19473121 2009 Association between renin-angiotensin-aldosterone system genotypes and haplotypes and risk of ischemic stroke of atherosclerotic etiology.
19369955 2009 Pretreatment levels of plasma renin activity predict ambulatory blood pressure response to valsartan in essential hypertension.
19243623 2009 Analysis of renin-angiotensin aldosterone system gene polymorphisms in Malaysian essential hypertensive and type 2 diabetic subjects.
19144755 2009 A new strategy to analyze possible association structures between dynamic nocturnal hormone activities and sleep alterations in humans.
19126660 2008 Association of renin-angiotensin system and natriuretic peptide receptor A gene polymorphisms with hypertension in a Hellenic population.
19082699 2009 The rationale and design of the PERindopril GENEtic association study (PERGENE): a pharmacogenetic analysis of angiotensin-converting enzyme inhibitor therapy in patients with stable coronary artery disease.
19073901 2009 Normotensive sodium loading in normal man: regulation of renin secretion during beta-receptor blockade.
19023100 2009 Exaggeration of focal cerebral ischemia in transgenic mice carrying human Renin and human angiotensinogen genes.
18953568 2008 Male-female differences in the genetic regulation of t-PA and PAI-1 levels in a Ghanaian population.
18922597 2008 Activated prorenin as a therapeutic target for diabetic nephropathy.
18856058 [Comparative genetic analysis of different forms of low-renin arterial hypertension].
18794727 2008 Genetic and gene expression studies implicate renin and endothelin-1 in edema caused by peroxisome proliferator-activated receptor gamma agonists.
18722896 2008 Left ventricular isovolumic relaxation and renin-angiotensin system in the growth restricted fetus.
18718746 2009 Effect of weight loss through laparoscopic gastric banding on blood pressure, plasma renin activity and aldosterone levels in morbid obesity.
18698213 2008 Prorenin engages the (pro)renin receptor like renin and both ligand activities are unopposed by aliskiren.
18632798 2008 Dysregulated human renin expression in transgenic mice carrying truncated genomic constructs: evidence supporting the presence of insulators at the renin locus.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
18508487 2008 Renin and prorenin disappearance in humans post-nephrectomy: evidence for binding?
18486430 2008 Renin and aldosterone but not the natriuretic peptide correlate with obsessive craving in medium-term abstinent alcohol-dependent patients: a longitudinal study.
18483152 2008 The Pal3 promoter sequence is critical for the regulation of human renin gene transcription by peroxisome proliferator-activated receptor-gamma.
18325076 2008 Genetic profile of ischemic cerebrovascular disease and carotid stenosis.
18260994 2008 [Contribution of CYP11B2, REN and AGT genes in genetic predisposition to arterial hypertension associated with hyperaldosteronism].
18259612 2008 A single nucleotide mutation in the mouse renin promoter disrupts blood pressure regulation.
18212269 2008 Prorenin and renin-induced extracellular signal-regulated kinase 1/2 activation in monocytes is not blocked by aliskiren or the handle-region peptide.
18205094 2007 Genetic polymorphisms of the renin-angiotensin system in preterm delivery and premature rupture of membranes.
18202178 2008 Mast cell renin and a local renin-angiotensin system in the airway: role in bronchoconstriction.
18192836 2008 Renin polymorphisms and haplotypes are associated with blood pressure levels and hypertension risk in postmenopausal women.
18188989 2007 Multiple risk factor clustering and risk of hypertension in the Mongolian ethnic population of China.
18175911 2008 The coexistence of Ser84 in renin and His13 in angiotensinogen brings a pH profile of two separate peaks to the reaction of human renin and sheep angiotensinogen.
18091737 2008 Pretreatment plasma renin activity levels correlate with the blood pressure response to telmisartan in essential hypertension.
18077515 2008 Chorionic enhancer is dispensable for regulated expression of the human renin gene.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17851801 2007 Alterations in the 'local umbilical cord blood renin-angiotensin system' during pre-eclampsia.
17785633 2007 Peroxisome proliferator-activated receptor-gamma is involved in the control of renin gene expression.
17703434 2007 Low-dose renin inhibitor and low-dose AT(1)-receptor blocker therapy ameliorate target-organ damage in rats harbouring human renin and angiotensinogen genes.
17693975 2007 A comparative study of plasma renin activity, aldosterone and atrial natriuretic hormone between normotensive and hypertensive people living at below sea level altitude (Jordan Valley) and those residing at moderate altitude above.
17660193 2007 Dissecting the action of an evolutionary conserved non-coding region on renin promoter activity.
17562974 2007 Renin gene polymorphisms and haplotypes, blood pressure, and responses to renin-angiotensin system inhibition.
17546276 2007 Combined analysis of genetic and environmental factors on essential hypertension in a brazilian rural population in the Amazon region.
17485830 2007 Ser84 of human renin contributes to the biphasic pH dependence of the renin-angiotensinogen reaction.
17476284 2007 Strong association of the renin TaqI polymorphism with essential hypertension in Chinese Han and Tibetan populations.
17455195 2007 A proximal direct repeat motif characterized as a negative regulatory element in the human renin gene.
17416596 2007 Angiotensin II-induced sudden arrhythmic death and electrical remodeling.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17158202 2007 Functional characterization of polymorphisms in the kidney enhancer of the human renin gene.
16990260 2006 The human renin kidney enhancer is required to maintain base-line renin expression but is dispensable for tissue-specific, cell-specific, and regulated expression.
16940215 2006 Prorenin induces intracellular signaling in cardiomyocytes independently of angiotensin II.
16933186 2006 Increased aldosterone/renin quotient in obese hypertensive women: a novel role for low-density lipoproteins?
16790508 2006 Renal tubular dysgenesis, a not uncommon autosomal recessive disorder leading to oligohydramnios: Role of the Renin-Angiotensin system.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16672053 2006 Chronic renal insufficiency among Asian Indians with type 2 diabetes: I. Role of RAAS gene polymorphisms.
16615274 2006 [Association analysis of the essential hypertension susceptibility genes in adolescents: Kangwha study].
16446393 2006 Evidence supporting a functional role for intracellular renin in the brain.
16396763 2006 Relevance of renin expression by real-time PCR in acute myeloid leukemia.
16375820 2005 The endothelin system and renin in human fetal membranes.
16189286 2006 Functional expression of the renin-angiotensin system in human podocytes.
16138564 2005 Strong association of a renin intronic dimorphism with essential hypertension.
16116425 2005 Mutations in genes in the renin-angiotensin system are associated with autosomal recessive renal tubular dysgenesis.
16036389 2005 Association study between the human Renin gene and preeclampsia.
15914769 2005 Spontaneous stroke in a genetic model of hypertension in mice.
15914614 2005 Genetic polymorphisms in the angiotensin II receptor gene and their association with open-angle glaucoma in a Japanese population.
15739123 2005 Plasma cathepsin D isoforms and their active metabolites increase after myocardial infarction and contribute to plasma renin activity.
15662219 2005 Genetic polymorphisms of the renin-angiotensin-aldosterone system and renal insufficiency in essential hypertension.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15368359 2004 Candidate cis-elements for human renin gene expression in the promoter region.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15075192 2004 Increased blood pressure in transgenic mice expressing both human renin and angiotensinogen in the renal proximal tubule.
15015130 2004 Haplotype diversity across 100 candidate genes for inflammation, lipid metabolism, and blood pressure regulation in two populations.
14530292 2003 Genetic determinants of nonmodulating hypertension.
12933794 2003 HADHB, HuR, and CP1 bind to the distal 3'-untranslated region of human renin mRNA and differentially modulate renin expression.
12862204 2003 A novel variable number of tandem repeat polymorphism of the renin gene and essential hypertension.
12854169 2003 Expression of local renin and angiotensinogen mRNA in cirrhotic portal hypertensive patient.
12736712 2003 Late-onset obesity in mice transgenic for the human renin gene.
12695419 2003 Associations between hypertension and genes in the renin-angiotensin system.
12684512 2003 Human prorenin has "gate and handle" regions for its non-proteolytic activation.
12613527 2002 Renin expression in hematological malignancies and its role in the regulation of hematopoiesis.
12569263 2003 Implication of Ref-1 in the repression of renin gene transcription by intracellular calcium.
12556231 2003 Genetic polymorphisms in the Renin-Angiotensin system in high-altitude and low-altitude Native American populations.
12544508 2003 A microarray minisequencing system for pharmacogenetic profiling of antihypertensive drug response.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473863 2002 Functionality of two new polymorphisms in the human renin gene enhancer region.
12431445 2002 Prorenin uptake in the heart: a prerequisite for local angiotensin generation?
12431442 2002 Local cardiac renin-angiotensin system: hypertension and cardiac failure.
12394950 2002 Angiotensin converting enzyme DD genotype is associated with hypertensive crisis.
12186695 2002 Circulating and local bone marrow renin-angiotensin system in leukemic hematopoiesis: preliminary evidences.
12045255 2002 Pivotal role of the renin/prorenin receptor in angiotensin II production and cellular responses to renin.
11967817 2000 Genetic basis of cardiovascular disease--the renin-angiotensin-aldosterone system as a paradigm.
11903315 2001 New elements in human renin promoter involved in cell-specific expression.
11847188 2002 Angiotensinogen and its cleaved derivatives inhibit angiogenesis.
11803527 2001 Alzheimer disease is not associated with polymorphisms in the angiotensinogen and renin genes.
11800056 2001 Left ventricular structure and diastolic function in subjects with two hypertensive parents.
11776100 2000 Relationship between the renin-angiotensin system genes and diabetic nephropathy in the Chinese.
11751703 2001 Angiotensin II type 2 receptors and cardiac hypertrophy in women with hypertrophic cardiomyopathy.
11409653 2001 Lack of correlation between Mbo I restriction fragment length polymorphism of renin gene and essential hypertension in Japanese.
11224002 2001 Haplotypes of the human renin gene associated with essential hypertension and stroke.
11098137 2000 Renin inhibits N-acetyl-D-glucosamine 2-epimerase (renin-binding protein).
11015597 2000 Identification of three human renin mRNA isoforms from alternative tissue-specific transcriptional initiation.
9933256 1999 Distinct renin isoforms generated by tissue-specific transcription initiation and alternative splicing.
9928950 1999 Prorenin processing by cathepsin B in vitro and in transfected cells.
8901832 1996 Prohormone convertase PC5 is a candidate processing enzyme for prorenin in the human adrenal cortex.
8735181 1996 Specific prorenin/renin binding (ProBP). Identification and characterization of a novel membrane site.
8494607 1993 Glycosylation of active human renin is necessary for secretion: effect of targeted modifications of Asn-5 and Asn-75.
8387539 1993 Gene expression of the renin-angiotensin system in human tissues. Quantitative analysis by the polymerase chain reaction.
8344672 Reassignment of human renin gene to chromosome 1q32 in studies of a (1;4)(q42;p16) translocation.
7584914 1995 Recent advances in the study of renin and angiotensinogen genes: from molecules to the whole body.
6398949 1984 Structure of the human renin gene.
6391881 1984 Primary structure of the human renin gene.
6324167 1983 Cloning and sequence analysis of cDNA for human renin precursor.
6138751 1983 Molecular cloning and nucleotide sequence of a human renin cDNA fragment.
6091130 1984 Structure of the human renin gene.
6089171 1984 Human renin gene: structure and sequence analysis.
4360430 1973 Kinetics of the reaction of human renin with natural substrates and tetradecapeptide substrate.
4330891 1971 Enzyme kinetic studies on human renin and its purified homologous substrate.
4322712 1971 Kinetics of the human renin and human substrate reaction.
4289389 1967 Kinetic constants of the human renin and human angiotensinogen reaction.
3542996 1987 Characterization of pure human renal renin. Evidence for a subunit structure.
3530608 1986 New possibilities for intracellular renin and inactive renin now that the structure of the human renin gene has been elucidated.
3516796 1986 Segmental homology between the promoter region of the human renin gene and the mouse ren1 and ren2 promoter regions.
3297510 1987 Chromosome localization of the human renin gene (REN) by in situ hybridization.
3288503 1988 Role of N-linked oligosaccharides attached to human renin expressed in COS cells.
3066525 1988 Characterization of N-linked oligosaccharides attached to human renin expressed in COS cells.
3032746 1986 Human renin gene of renin-secreting tumor.
2960682 1987 Renin, a secretory glycoprotein, acquires phosphomannosyl residues.
2540188 1989 Identification of negative and positive regulatory elements in the human renin gene.
2493678 1989 Structure of recombinant human renin, a target for cardiovascular-active drugs, at 2.5 A resolution.
2450565 1988 Characterization of five epitopes of human renin from a computer model.
2203348 1990 The purification and characterization of recombinant human renin expressed in the human kidney cell line 293.
2186807 1990 Substrate specificity of recombinant human renal renin: effect of histidine in the P2 subsite on pH dependence.
2061332 1991 Identification of renal cathepsin B as a human prorenin-processing enzyme.
2017226 1991 Renal hemodynamics and the renin-angiotensin-aldosterone system in normotensive subjects with hypertensive and normotensive parents.
2016271 1991 Isolation and characterization of recombinant human prorenin in Chinese hamster ovary cells.
1608447 1992 X-ray analyses of peptide-inhibitor complexes define the structural basis of specificity for human and mouse renins.
1597471 1992 Proprotein conversion is determined by a multiplicity of factors including convertase processing, substrate specificity, and intracellular environment. Cell type-specific processing of human prorenin by the convertase PC1.