Property Summary

Ligand Count 27
NCBI Gene PubMed Count 1,051
PubMed Score 988.49
PubTator Score 2032.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 5.03 2.5

Expression

  Differential Expression (11)

Disease log2 FC p
ependymoma 1.300 7.0e-03
adult high grade glioma 1.200 9.8e-05
astrocytoma 1.900 1.4e-04
atypical teratoid / rhabdoid tumor 1.300 4.5e-07
colon cancer -1.600 3.2e-02
glioblastoma 1.200 2.2e-02
group 4 medulloblastoma 1.100 6.1e-04
Multiple myeloma 1.244 4.9e-04
oligodendroglioma 1.300 7.2e-03
ovarian cancer 1.400 1.4e-04
primitive neuroectodermal tumor 1.100 4.8e-02

Protein-protein Interaction (3)

Gene RIF (914)

AA Sequence

MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPG      1 - 70
TVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNP     71 - 140
FQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGD    141 - 210
EIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDREL    211 - 280
SEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYP    281 - 350
FTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA    351 - 420
VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTE    421 - 490
PMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS             491 - 551
//

Text Mined References (1072)

PMID Year Title