Property Summary

NCBI Gene PubMed Count 59
PubMed Score 128.11
PubTator Score 106.05

Knowledge Summary

Patent

No data available

Expression

Gene RIF (52)

AA Sequence

MASRSMRLLLLLSCLAKTGVLGDIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASI      1 - 70
LSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLT     71 - 140
WSSNECNKRQHFLCKYRP                                                        141 - 158
//

Text Mined References (59)

PMID Year Title